Gene/Proteome Database (LMPD)
Proteins
| Protein F09C8.1 | |
|---|---|
| Refseq ID | NP_510636 |
| Protein GI | 25152773 |
| UniProt ID | O01300 |
| mRNA ID | NM_078235 |
| Length | 374 |
| MWRRVFVFSCIFLYVLATLPDFGIPGYSCDANVMKKSKKVPTNVNSVRPADIKLIMALGDSLTAANGAGAEDPVAVVLQYRGLAFQAGGDKTLEEHVTIPNILKKYNPDVFGYSNGIGSPNVWEIARLNVAMPGANAKDLPGQARQLVQLLQQHTEVVNMKEDWKLLNIFIGGNDICGYCRKPVEDSPYNCAQDIKQAVQIIYDNVPRVIVSLTGMLHLEMLRQTDTGHWFCQRLHHDECGCESNKNFTDADIRQACYDYNKYEKQIETDGTFEKNDFTYVVQPMFQDTLIPPMENGKPTQKFFAPDCFHFSQWGHALVSTYLWNNILQPVGSKSTVSNMSVPLQTLACPDAACPFIRTPKNSQDCSQYMTPHA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5653397 | Acyl chain remodelling of PC |
| 5652494 | Disease |
| 5652609 | Diseases associated with visual transduction |
| 5652685 | Glycerophospholipid biosynthesis |
| 5652491 | Metabolism |
| 5652530 | Metabolism of lipids and lipoproteins |
| 5652686 | Phospholipid metabolism |
| 5653332 | Retinoid metabolism and transport |
| 5652608 | Signal Transduction |
| 5652607 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008054 (as displayed in Record Overview)
Identical Sequences to LMP008054 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP008054 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|