Gene/Proteome Database (LMPD)
Proteins
Protein F09C8.1 | |
---|---|
Refseq ID | NP_510636 |
Protein GI | 25152773 |
UniProt ID | O01300 |
mRNA ID | NM_078235 |
Length | 374 |
MWRRVFVFSCIFLYVLATLPDFGIPGYSCDANVMKKSKKVPTNVNSVRPADIKLIMALGDSLTAANGAGAEDPVAVVLQYRGLAFQAGGDKTLEEHVTIPNILKKYNPDVFGYSNGIGSPNVWEIARLNVAMPGANAKDLPGQARQLVQLLQQHTEVVNMKEDWKLLNIFIGGNDICGYCRKPVEDSPYNCAQDIKQAVQIIYDNVPRVIVSLTGMLHLEMLRQTDTGHWFCQRLHHDECGCESNKNFTDADIRQACYDYNKYEKQIETDGTFEKNDFTYVVQPMFQDTLIPPMENGKPTQKFFAPDCFHFSQWGHALVSTYLWNNILQPVGSKSTVSNMSVPLQTLACPDAACPFIRTPKNSQDCSQYMTPHA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5653397 | Acyl chain remodelling of PC |
5652494 | Disease |
5652609 | Diseases associated with visual transduction |
5652685 | Glycerophospholipid biosynthesis |
5652491 | Metabolism |
5652530 | Metabolism of lipids and lipoproteins |
5652686 | Phospholipid metabolism |
5653332 | Retinoid metabolism and transport |
5652608 | Signal Transduction |
5652607 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008054 (as displayed in Record Overview)
Identical Sequences to LMP008054 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP008054 proteins
Reference | Database | Accession | Length | Protein Name |
---|