Gene/Proteome Database (LMPD)
Proteins
Protein STDH-3 | |
---|---|
Refseq ID | NP_506448 |
Protein GI | 212646214 |
UniProt ID | Q17704 |
mRNA ID | NM_074047 |
Length | 315 |
MNIEWFAIGVGAIVVLYILYHFIKMIWSILGLYVFYQPIDLKKKAGASWAVITGGTDGIGKSFSFELAKRGFNIYIVSRTQSKLEQTKKEIMEKYSNVEVRFATFDFTNPSISDYKKLLSQLNEVSIGMLINNVGMLFEYPENLHKTVGGIDVVANVTILNTLPVTLLSAGILPQMVSRKTGIIVNIGSVAGAAKMAEWSVYSASKKYVEWLTGCLRKEYEHQGIIIQAITPALVATKLSGHTETSLFCPDSATFAKSALNTVGHTSQTTGYINHQIQCEMLALFPECFLDSFVKKSSVETREKALAKKENKHLL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
GO:0006694 | IEA:UniProtKB-KW | P | steroid biosynthetic process |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5652986 | Androgen biosynthesis |
5652674 | Fatty Acyl-CoA Biosynthesis |
5652529 | Fatty acid, triacylglycerol, and ketone body metabolism |
5652491 | Metabolism |
5652530 | Metabolism of lipids and lipoproteins |
5652987 | Metabolism of steroid hormones and vitamin D |
5652683 | Synthesis of very long-chain fatty acyl-CoAs |
5652675 | Triglyceride Biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008057 (as displayed in Record Overview)
Identical Sequences to LMP008057 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP008057 proteins
Reference | Database | Accession | Length | Protein Name |
---|