Gene/Proteome Database (LMPD)
Proteins
| Protein STDH-4 | |
|---|---|
| Refseq ID | NP_505205 |
| Protein GI | 392919738 |
| UniProt ID | O16925 |
| mRNA ID | NM_072804 |
| Length | 263 |
| MKVVTGATDGIGRSYALDLARRGFNIFLISRTKSKLVKTKKQILNKYSDIEVRYAICDFTRVSYEDYKRLLHSLNEVDIGILINNVGMCFDNPEVLHRVEGGIDTLTNVINVNILPVTLLTAGILPQMMARKSGIIVNIGSAAGSIHMAKWSVYSATKKYIEWFTSILQKEYENEGIICQTITPLLVSTNMIKNPLSSIFCPNSDSFAKSSLNTIGNSSSTTGYITHQIQFELIKFVPEIIIDLFVKNLNNQLLDYQLDKKRV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
| GO:0006694 | IEA:UniProtKB-KW | P | steroid biosynthetic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5652986 | Androgen biosynthesis |
| 5652674 | Fatty Acyl-CoA Biosynthesis |
| 5652529 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5652491 | Metabolism |
| 5652530 | Metabolism of lipids and lipoproteins |
| 5652987 | Metabolism of steroid hormones and vitamin D |
| 5652683 | Synthesis of very long-chain fatty acyl-CoAs |
| 5652675 | Triglyceride Biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008073 (as displayed in Record Overview)
Identical Sequences to LMP008073 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP008073 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|