Gene/Proteome Database (LMPD)
Proteins
Protein SQV-3 | |
---|---|
Refseq ID | NP_499164 |
Protein GI | 17554812 |
UniProt ID | P34548 |
mRNA ID | NM_066763 |
Length | 289 |
RefSeq Status | REVIEWED |
MKLKTRLILSGTILISLAACYFLVLLVLDLEITRDLMTDYVDPRPLQTSYHKLCVIVPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQTDPLRFNRASLINVGWNEADRLGCDYMVMNDVDLLPVNPEVPYDFPGIGVIRHITSPQYHPKYHYEKFIGGILMLTLKDYKKLNGMSNKYWGWGLEDDEFYLRIIDSKLNLTRVSGLSTDSSNTFRHIHGPKRKRDYTPKKNDKNQWEIKRKRDHVSGLHDVRYLIDSRQLLDFSGTSVTIINVALHCDLNWTPYCKS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016020 | IDA:WormBase | C | membrane |
GO:0008378 | IDA:WormBase | F | galactosyltransferase activity |
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
GO:0030206 | IMP:WormBase | P | chondroitin sulfate biosynthetic process |
GO:0009792 | IMP:WormBase | P | embryo development ending in birth or egg hatching |
GO:0015012 | IMP:WormBase | P | heparan sulfate proteoglycan biosynthetic process |
GO:0002009 | IMP:WormBase | P | morphogenesis of an epithelium |
GO:0018991 | IMP:WormBase | P | oviposition |
GO:0022604 | IMP:WormBase | P | regulation of cell morphogenesis |
GO:0000003 | IMP:WormBase | P | reproduction |
GO:0040025 | IMP:WormBase | P | vulval development |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
cel00532 | Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate |
cel00534 | Glycosaminoglycan biosynthesis - heparan sulfate / heparin |
cel_M00057 | Glycosaminoglycan biosynthesis, linkage tetrasaccharide |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5653446 | A tetrasaccharide linker sequence is required for GAG synthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Similarity | Belongs to the glycosyltransferase 7 family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008191 (as displayed in Record Overview)
Identical Sequences to LMP008191 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17554812 | EMBL | CAA82350.1 | 289 | Protein SQV-3 [Caenorhabditis elegans] |
GI:17554812 | EMBL | CAA06744.1 | 289 | Sqv-3 protein [Caenorhabditis elegans] |
GI:17554812 | SwissProt | P34548.1 | 289 | RecName: Full=Probable galactosyltransferase sqv-3; AltName: Full=Squashed vulva protein 3 [Caenorhabditis elegans] |
Related Sequences to LMP008191 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17554812 | EMBL | CAP29491.2 | 285 | Protein CBR-SQV-3 [Caenorhabditis briggsae] |
GI:17554812 | GenBank | EFP09255.1 | 285 | CRE-SQV-3 protein [Caenorhabditis remanei] |
GI:17554812 | GenBank | EGT33520.1 | 285 | CBN-SQV-3 protein [Caenorhabditis brenneri] |
GI:17554812 | GenBank | EYB91428.1 | 320 | hypothetical protein Y032_0206g1989 [Ancylostoma ceylanicum] |
GI:17554812 | RefSeq | XP_002641643.1 | 322 | C. briggsae CBR-SQV-3 protein [Caenorhabditis briggsae] |
GI:17554812 | RefSeq | XP_003113001.1 | 285 | CRE-SQV-3 protein [Caenorhabditis remanei] |