Gene/Proteome Database (LMPD)

LMPD ID
LMP008191
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein SQV-3
Gene Symbol
Synonyms
CELE_R10E11.4
Alternate Names
Protein SQV-3
Chromosome
III
EC Number
2.4.1.-

Proteins

Protein SQV-3
Refseq ID NP_499164
Protein GI 17554812
UniProt ID P34548
mRNA ID NM_066763
Length 289
RefSeq Status REVIEWED
MKLKTRLILSGTILISLAACYFLVLLVLDLEITRDLMTDYVDPRPLQTSYHKLCVIVPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQTDPLRFNRASLINVGWNEADRLGCDYMVMNDVDLLPVNPEVPYDFPGIGVIRHITSPQYHPKYHYEKFIGGILMLTLKDYKKLNGMSNKYWGWGLEDDEFYLRIIDSKLNLTRVSGLSTDSSNTFRHIHGPKRKRDYTPKKNDKNQWEIKRKRDHVSGLHDVRYLIDSRQLLDFSGTSVTIINVALHCDLNWTPYCKS

Gene Information

Entrez Gene ID
Gene Name
Protein SQV-3
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:WormBase C membrane
GO:0008378 IDA:WormBase F galactosyltransferase activity
GO:0005975 IEA:InterPro P carbohydrate metabolic process
GO:0030206 IMP:WormBase P chondroitin sulfate biosynthetic process
GO:0009792 IMP:WormBase P embryo development ending in birth or egg hatching
GO:0015012 IMP:WormBase P heparan sulfate proteoglycan biosynthetic process
GO:0002009 IMP:WormBase P morphogenesis of an epithelium
GO:0018991 IMP:WormBase P oviposition
GO:0022604 IMP:WormBase P regulation of cell morphogenesis
GO:0000003 IMP:WormBase P reproduction
GO:0040025 IMP:WormBase P vulval development

KEGG Pathway Links

KEGG Pathway ID Description
cel00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
cel00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
cel_M00057 Glycosaminoglycan biosynthesis, linkage tetrasaccharide

REACTOME Pathway Links

REACTOME Pathway ID Description
5653446 A tetrasaccharide linker sequence is required for GAG synthesis

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
Protein SQV-3
Protein Entry
SQV3_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Similarity Belongs to the glycosyltransferase 7 family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008191 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17554812 RefSeq NP_499164 289 Protein SQV-3

Identical Sequences to LMP008191 proteins

Reference Database Accession Length Protein Name
GI:17554812 EMBL CAA82350.1 289 Protein SQV-3 [Caenorhabditis elegans]
GI:17554812 EMBL CAA06744.1 289 Sqv-3 protein [Caenorhabditis elegans]
GI:17554812 SwissProt P34548.1 289 RecName: Full=Probable galactosyltransferase sqv-3; AltName: Full=Squashed vulva protein 3 [Caenorhabditis elegans]

Related Sequences to LMP008191 proteins

Reference Database Accession Length Protein Name
GI:17554812 EMBL CAP29491.2 285 Protein CBR-SQV-3 [Caenorhabditis briggsae]
GI:17554812 GenBank EFP09255.1 285 CRE-SQV-3 protein [Caenorhabditis remanei]
GI:17554812 GenBank EGT33520.1 285 CBN-SQV-3 protein [Caenorhabditis brenneri]
GI:17554812 GenBank EYB91428.1 320 hypothetical protein Y032_0206g1989 [Ancylostoma ceylanicum]
GI:17554812 RefSeq XP_002641643.1 322 C. briggsae CBR-SQV-3 protein [Caenorhabditis briggsae]
GI:17554812 RefSeq XP_003113001.1 285 CRE-SQV-3 protein [Caenorhabditis remanei]