Gene/Proteome Database (LMPD)
Proteins
| Protein F01G4.5 | |
|---|---|
| Refseq ID | NP_502086 |
| Protein GI | 71985996 |
| UniProt ID | Q93438 |
| mRNA ID | NM_069685 |
| Length | 269 |
| RefSeq Status | REVIEWED |
| MDKITKNVVLIRTLEAKILLVRTFSFTRLLLLDVAFSIYLWNIWTPNWEWTVNEFWDQTGNVADNLNGTITWLRSNPAGLKLNTPVNETLAWFFTYHIYLWTTFIGFLRSDAFFRFIAYSLIGGISTFSAMVYDFSQIFFLHFNCFDAYATKLCYLCYYTLTVLWSLVRGKKWNPLRERKDTVILDTRQQFLATSLFVILLFILPTIFVYFVVFRCLRLAVSALQTVLYFFATWPFQLFALEKHLAEKYGKPADAQNEALAEKKTKSQN | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:WormBase | C | endoplasmic reticulum |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0017176 | IEA:InterPro | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006506 | IEA:InterPro | P | GPI anchor biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007720 | N-acetylglucosaminyl transferase component |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008241 (as displayed in Record Overview)
Identical Sequences to LMP008241 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71985996 | EMBL | CAA92766.2 | 269 | Protein F01G4.5 [Caenorhabditis elegans] |
Related Sequences to LMP008241 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71985996 | EMBL | CAP26343.1 | 248 | Protein CBG06019 [Caenorhabditis briggsae] |
| GI:71985996 | GenBank | EFO93690.1 | 278 | hypothetical protein CRE_12775 [Caenorhabditis remanei] |
| GI:71985996 | GenBank | EFP02270.1 | 264 | hypothetical protein CRE_26044 [Caenorhabditis remanei] |
| GI:71985996 | GenBank | EGT36302.1 | 266 | hypothetical protein CAEBREN_30799 [Caenorhabditis brenneri] |
| GI:71985996 | RefSeq | XP_003087264.1 | 264 | hypothetical protein CRE_26044 [Caenorhabditis remanei] |
| GI:71985996 | RefSeq | XP_003107791.1 | 278 | hypothetical protein CRE_12775 [Caenorhabditis remanei] |