Gene/Proteome Database (LMPD)
Proteins
| Protein T21H3.1, isoform a | |
|---|---|
| Refseq ID | NP_001024152 |
| Protein GI | 72000666 |
| UniProt ID | H2KZV5 |
| mRNA ID | NM_001028981 |
| Length | 305 |
| RefSeq Status | REVIEWED |
| MQALLLAAVLLPLASAFVLPEAPKNPENLDVYTIPYNDATARKKILFAAGAAYGSNPQQCLDKAFTGASIRRIITARCDVNPADKCVGYTAVSPQDKAIIVVFRGTNNNVQLILEGLETVFEYHTPWAAGGVVSQYFNDGFLNIWNAGLKDDFNTLAAQNPGFQVWVTGHSLGGAMASLAASYITYNKLFDASKLQLVTYGQPRVGDKAYAAAVDRDVTNKFRVTHAHDPVPHLPKENMQGFTHHKAEVFYKEKMTKYNICDDIDESEFCSNGQVLPDTSIKDHLHYFDVDVSDLGYSNCANVKN | |
| Protein T21H3.1, isoform b | |
|---|---|
| Refseq ID | NP_001024153 |
| Protein GI | 72000668 |
| UniProt ID | Q4W525 |
| mRNA ID | NM_001028982 |
| Length | 130 |
| RefSeq Status | REVIEWED |
| MASLAASYITYNKLFDASKLQLVTYGQPRVGDKAYAAAVDRDVTNKFRVTHAHDPVPHLPKENMQGFTHHKAEVFYKEKMTKYNICDDIDESEFCSNGQVLPDTSIKDHLHYFDVDVSDLGYSNCANVKN | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008259 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 72000666 | RefSeq | NP_001024152 | 305 | Protein T21H3.1, isoform a |
| 72000668 | RefSeq | NP_001024153 | 130 | Protein T21H3.1, isoform b |
Identical Sequences to LMP008259 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:72000666 | EMBL | CCD69966.1 | 305 | Protein T21H3.1, isoform a [Caenorhabditis elegans] |
| GI:72000668 | EMBL | CCD69967.1 | 130 | Protein T21H3.1, isoform b [Caenorhabditis elegans] |
Related Sequences to LMP008259 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:72000668 | EMBL | CAP22403.1 | 304 | Protein CBG01095 [Caenorhabditis briggsae] |
| GI:72000666 | EMBL | CAP22403.1 | 304 | Protein CBG01095 [Caenorhabditis briggsae] |
| GI:72000668 | EMBL | CCD69966.1 | 305 | Protein T21H3.1, isoform a [Caenorhabditis elegans] |
| GI:72000666 | EMBL | CDJ90391.1 | 284 | Lipase domain containing protein [Haemonchus contortus] |
| GI:72000668 | EMBL | CDJ90391.1 | 284 | Lipase domain containing protein [Haemonchus contortus] |
| GI:72000666 | GenBank | EGT44024.1 | 288 | hypothetical protein CAEBREN_02376 [Caenorhabditis brenneri] |
| GI:72000668 | GenBank | ETN86882.1 | 158 | triacylglycerol lipase [Necator americanus] |
| GI:72000666 | GenBank | EYC39101.1 | 294 | hypothetical protein Y032_0675g1419 [Ancylostoma ceylanicum] |
| GI:72000666 | GenBank | EYC39102.1 | 282 | hypothetical protein Y032_0675g1419 [Ancylostoma ceylanicum] |
| GI:72000668 | RefSeq | NP_001024152.1 | 305 | Protein T21H3.1, isoform a [Caenorhabditis elegans] |
| GI:72000668 | RefSeq | XP_002635877.1 | 304 | Hypothetical protein CBG01095 [Caenorhabditis briggsae] |
| GI:72000666 | RefSeq | XP_002635877.1 | 304 | Hypothetical protein CBG01095 [Caenorhabditis briggsae] |