Gene/Proteome Database (LMPD)

LMPD ID
LMP008313
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein LBP-2
Gene Symbol
Synonyms
CELE_F40F4.2
Alternate Names
Protein LBP-2
Chromosome
X

Proteins

Protein LBP-2
Refseq ID NP_508558
Protein GI 17568901
UniProt ID Q20224
mRNA ID NM_076157
Length 161
RefSeq Status REVIEWED
MSSKFLILLAFCGATLVAAEQLPEKFYGTFDLDHSENFDEYLTAKGYGWFTRKLVTFATFKKVFAKNANKNLFDYSNLTSKKDVFYKNVQIGSKFEGEGLDNTKHEVTFTLKDGHLFEHHKPLEEGESKEETYEYYFDGDFLIQKMSFNNIEGRRFYKRLP

Gene Information

Entrez Gene ID
Gene Name
Protein LBP-2
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
Protein LBP-2
Protein Entry
FABP2_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000250}.
Function May play a role in sequestering potentially toxic fatty acids and their peroxidation products, or it may be involved in the maintenance of the impermeable lipid layer of the eggshell. {ECO:0000269|PubMed:10693745}.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000269|PubMed:10693745}. Note=From muscle into the perienteric fluid.

Identical and Related Proteins

Unique RefSeq proteins for LMP008313 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17568901 RefSeq NP_508558 161 Protein LBP-2

Identical Sequences to LMP008313 proteins

Reference Database Accession Length Protein Name
GI:17568901 EMBL CCD70141.1 161 Protein LBP-2 [Caenorhabditis elegans]
GI:17568901 SwissProt Q20224.1 161 RecName: Full=Fatty acid-binding protein homolog 2; AltName: Full=Lipid-binding protein 2; Flags: Precursor [Caenorhabditis elegans]

Related Sequences to LMP008313 proteins

Reference Database Accession Length Protein Name
GI:17568901 EMBL CCD70142.1 159 Protein LBP-1 [Caenorhabditis elegans]
GI:17568901 GenBank EFO82810.1 271 hypothetical protein CRE_00913 [Caenorhabditis remanei]
GI:17568901 GenBank EGT30139.1 209 CBN-LBP-2 protein [Caenorhabditis brenneri]
GI:17568901 RefSeq NP_508557.1 159 Protein LBP-1 [Caenorhabditis elegans]
GI:17568901 RefSeq XP_003118212.1 271 hypothetical protein CRE_00913 [Caenorhabditis remanei]
GI:17568901 SwissProt Q20223.1 159 RecName: Full=Fatty acid-binding protein homolog 1; AltName: Full=Lipid-binding protein 1; Flags: Precursor [Caenorhabditis elegans]