Gene/Proteome Database (LMPD)
Proteins
Protein F25A2.1 | |
---|---|
Refseq ID | NP_503390 |
Protein GI | 193207843 |
UniProt ID | O16189 |
mRNA ID | NM_070989 |
Length | 290 |
MLFIFSVLICKSFSHSSIPYSDQLSRNKLIYAAISAYASPPQSCMSLAFQNFQVKPQITVACDTLDDTCSGFTGVDHESQAILVAFRGTNRNAQLLVEAVETVFANNKSWVSGGHVSEYFSDAFFKIWTSGMKDDVISLMSRYPSYQVWVTGHSLGGALASLAATYLRYTSLVSADQLLLVTFGQPRTGNMDFATSVDNLVPNAYRVTHSHDPVPHLPGQGHHGYFHHKSEVYYNKNMGGWEICEKDESEKCSNGNLVDLDFEDHFHYFNLDILKLGFSNCLNTTPSGIQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008365 (as displayed in Record Overview)
Identical Sequences to LMP008365 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP008365 proteins
Reference | Database | Accession | Length | Protein Name |
---|