Gene/Proteome Database (LMPD)
Proteins
| Protein F25A2.1 | |
|---|---|
| Refseq ID | NP_503390 |
| Protein GI | 193207843 |
| UniProt ID | O16189 |
| mRNA ID | NM_070989 |
| Length | 290 |
| MLFIFSVLICKSFSHSSIPYSDQLSRNKLIYAAISAYASPPQSCMSLAFQNFQVKPQITVACDTLDDTCSGFTGVDHESQAILVAFRGTNRNAQLLVEAVETVFANNKSWVSGGHVSEYFSDAFFKIWTSGMKDDVISLMSRYPSYQVWVTGHSLGGALASLAATYLRYTSLVSADQLLLVTFGQPRTGNMDFATSVDNLVPNAYRVTHSHDPVPHLPGQGHHGYFHHKSEVYYNKNMGGWEICEKDESEKCSNGNLVDLDFEDHFHYFNLDILKLGFSNCLNTTPSGIQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008365 (as displayed in Record Overview)
Identical Sequences to LMP008365 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP008365 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|