Gene/Proteome Database (LMPD)
Proteins
| Protein C17D12.1, isoform a | |
|---|---|
| Refseq ID | NP_492960 |
| Protein GI | 17505601 |
| UniProt ID | Q9U3P7 |
| mRNA ID | NM_060559 |
| Length | 302 |
| RefSeq Status | REVIEWED |
| MFKWDPCGLVCVCMIYLLIAYADYVILIWLLLPTFGHSIWTVFHGAVFNCLLATTIVAHTRAMLSDPGTVPISSSKGQNTPNPVFSSDEEDESDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPLGENLYHAKVIHSIMLAMESALFGLFVLAVSCDQLGAIFTDETAIESVQRRGRNYLASSRRPRNSKVAMMKQVCGPGPKLLWLIPCANPQKSTPRYLRTHNQLAHFDV | |
| Protein C17D12.1, isoform b | |
|---|---|
| Refseq ID | NP_492961 |
| Protein GI | 17505603 |
| UniProt ID | Q8I4M8 |
| mRNA ID | NM_060560 |
| Length | 240 |
| RefSeq Status | REVIEWED |
| MLSDPGTVPISSSKGQNTPNPVFSSDEEDESDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKWFLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPLGENLYHAKVIHSIMLAMESALFGLFVLAVSCDQLGAIFTDETAIESVQRRGRNYLASSRRPRNSKVAMMKQVCGPGPKLLWLIPCANPQKSTPRYLRTHNQLAHFDV | |
Gene Information
Entrez Gene ID
Gene Name
Protein C17D12.1
Gene Symbol
Species
Caenorhabditis elegans
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008415 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17505601 | RefSeq | NP_492960 | 302 | Protein C17D12.1, isoform a |
| 17505603 | RefSeq | NP_492961 | 240 | Protein C17D12.1, isoform b |
Identical Sequences to LMP008415 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17505601 | EMBL | CAB03897.1 | 302 | Protein DHHC-7, isoform a [Caenorhabditis elegans] |
| GI:17505603 | EMBL | CAB03898.1 | 240 | Protein DHHC-7, isoform b [Caenorhabditis elegans] |
Related Sequences to LMP008415 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17505603 | EMBL | CAB03897.1 | 302 | Protein DHHC-7, isoform a [Caenorhabditis elegans] |
| GI:17505601 | EMBL | CAB03898.1 | 240 | Protein DHHC-7, isoform b [Caenorhabditis elegans] |
| GI:17505601 | GenBank | EFP12237.1 | 591 | hypothetical protein CRE_04251 [Caenorhabditis remanei] |
| GI:17505603 | GenBank | EFP12237.1 | 591 | hypothetical protein CRE_04251 [Caenorhabditis remanei] |
| GI:17505601 | GenBank | EGT31830.1 | 267 | hypothetical protein CAEBREN_03871 [Caenorhabditis brenneri] |
| GI:17505603 | GenBank | EGT31830.1 | 267 | hypothetical protein CAEBREN_03871 [Caenorhabditis brenneri] |
| GI:17505603 | RefSeq | NP_492960.1 | 302 | Protein DHHC-7, isoform a [Caenorhabditis elegans] |
| GI:17505601 | RefSeq | NP_492961.1 | 240 | Protein DHHC-7, isoform b [Caenorhabditis elegans] |
| GI:17505603 | RefSeq | XP_002640545.1 | 225 | Hypothetical protein CBG15806, partial [Caenorhabditis briggsae] |
| GI:17505601 | RefSeq | XP_002640545.1 | 225 | Hypothetical protein CBG15806, partial [Caenorhabditis briggsae] |
| GI:17505603 | RefSeq | XP_003098684.1 | 591 | hypothetical protein CRE_04251 [Caenorhabditis remanei] |
| GI:17505601 | RefSeq | XP_003098684.1 | 591 | hypothetical protein CRE_04251 [Caenorhabditis remanei] |