Gene/Proteome Database (LMPD)

LMPD ID
LMP008801
Gene ID
38784
Species
Drosophila melanogaster (Drosophila)
Gene Name
Diazepam-binding inhibitor
Gene Symbol
Dbi
Synonyms
ACBP; anon-WO0172774.131; BcDNA:RH39533; CG8627; dbi; DBI; Dmel\CG8627
Alternate Names
CG8627-PA; CG8627-PB; Dbi-PA; Dbi-PB; Diazepam-binding inhibitor; acyl-CoA binding protein; diazepam binding inhibitor; diazepam-binding protein; endozepine
Chromosome
3L
Map Location
65E4-65E4

Proteins

Diazepam-binding inhibitor, isoform A
Refseq ID NP_729218
Protein GI 24659809
UniProt ID P42281
mRNA ID NM_168192
Length 86
RefSeq Status REVIEWED
Protein sequence is identical to GI:24659814 (mRNA isoform)
Diazepam-binding inhibitor, isoform B
Refseq ID NP_523952
Protein GI 24659814
UniProt ID P42281
mRNA ID NM_079228
Length 86
RefSeq Status REVIEWED
MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDLKGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYA

Gene Information

Entrez Gene ID
38784
Gene Name
Diazepam-binding inhibitor
Gene Symbol
Dbi
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000062 ISS:FlyBase F fatty-acyl-CoA binding
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0042049 ISS:FlyBase P cellular acyl-CoA homeostasis
GO:0006810 IEA:UniProtKB-KW P transport

Domain Information

InterPro Annotations

Accession Description
IPR000582 Acyl-CoA-binding protein, ACBP
IPR022408 Acyl-CoA-binding protein, ACBP, conserved site
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle

UniProt Annotations

Entry Information

Gene Name
Diazepam-binding inhibitor
Protein Entry
ACBP_DROME
UniProt ID
P42281
Species
Drosophila

Comments

Comment Type Description
Developmental Stage Expressed from the larval stage onwards throughout the adult stage. {ECO:0000269|PubMed:7935415}.
Function Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters (By similarity). May be involved in energy metabolism in a manner that depends on the substrate used for energy production. Dbi and its metabolites are involved in the regulation of multiple biological processes. {ECO:0000250, ECO:0000269|PubMed:7935415}.
Similarity Belongs to the ACBP family. {ECO:0000305}.
Similarity Contains 1 ACB (acyl-CoA-binding) domain. {ECO:0000255|PROSITE-ProRule:PRU00573}.
Tissue Specificity Expressed in larval and pupal brains. In adults, expressed in cardia, part of the Malpighian tubules, fat body, and gametes of both sexes. {ECO:0000269|PubMed:7935415}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008801 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
24659814 RefSeq NP_523952 86 Diazepam-binding inhibitor, isoform B

Identical Sequences to LMP008801 proteins

Reference Database Accession Length Protein Name
GI:24659814 GenBank AAL48175.1 86 RH39533p [Drosophila melanogaster]
GI:24659814 GenBank ACL87929.1 86 Dbi-PA, partial [synthetic construct]
GI:24659814 GenBank ACL92325.1 86 Dbi-PA [synthetic construct]
GI:24659814 gnl FlyBase 86 Diazepam-binding inhibitor, isoform A [Drosophila melanogaster]
GI:24659814 gnl FlyBase 86 Diazepam-binding inhibitor, isoform B [Drosophila melanogaster]
GI:24659814 RefSeq NP_729218.1 86 Diazepam-binding inhibitor, isoform A [Drosophila melanogaster]

Related Sequences to LMP008801 proteins

Reference Database Accession Length Protein Name
GI:24659814 GenBank EDV50520.1 86 GG14406 [Drosophila erecta]
GI:24659814 GenBank EDW93710.1 86 GE21596 [Drosophila yakuba]
GI:24659814 GenBank EDX09521.1 86 GD13995 [Drosophila simulans]
GI:24659814 RefSeq XP_001971494.1 86 GG14406 [Drosophila erecta]
GI:24659814 RefSeq XP_002093998.1 86 GE21596 [Drosophila yakuba]
GI:24659814 RefSeq XP_002083936.1 86 GD13995 [Drosophila simulans]