Gene/Proteome Database (LMPD)
Proteins
| CMP-sialic acid synthase | |
|---|---|
| Refseq ID | NP_730474 |
| Protein GI | 24667125 |
| UniProt ID | Q8IQV0 |
| mRNA ID | NM_168828 |
| Length | 187 |
| RefSeq Status | REVIEWED |
| MTIKNSTCFRHIWVSTDDKRIAIEAQKYGAIIHHRPEKFARDDTPSLHAISEFLDVHRSIHDFALFQCTSVFLKTKYIQEAVRKFESHDCVFAAKRSHYLRWKVVDGELMPAEFDLSARPRRQDWQGDIVETGMFYFSRRKLVDSGLLQNNRCSVVEIDAKDSLEIDSSHDLTLAKYILSSETKTEL | |
Gene Information
Entrez Gene ID
Gene Name
CMP-sialic acid synthase
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005802 | IDA:FlyBase | C | trans-Golgi network |
| GO:0008781 | IDA:FlyBase | F | N-acylneuraminate cytidylyltransferase activity |
| GO:0009103 | IEA:InterPro | P | lipopolysaccharide biosynthetic process |
| GO:0009408 | IMP:FlyBase | P | response to heat |
| GO:0007268 | IMP:FlyBase | P | synaptic transmission |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008864 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 24667125 | RefSeq | NP_730474 | 187 | CMP-sialic acid synthase |
Identical Sequences to LMP008864 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24667125 | gnl | FlyBase | 187 | CMP-sialic acid synthase [Drosophila melanogaster] |
Related Sequences to LMP008864 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24667125 | GenBank | ABB36422.1 | 187 | RH11815p [Drosophila melanogaster] |
| GI:24667125 | GenBank | EDW49859.1 | 187 | GM14951 [Drosophila sechellia] |
| GI:24667125 | GenBank | EDX11156.1 | 187 | GD12235 [Drosophila simulans] |
| GI:24667125 | GenBank | ACH92492.1 | 238 | FI09407p, partial [Drosophila melanogaster] |
| GI:24667125 | RefSeq | XP_002043648.1 | 187 | GM14951 [Drosophila sechellia] |
| GI:24667125 | RefSeq | XP_002085571.1 | 187 | GD12235 [Drosophila simulans] |