Gene/Proteome Database (LMPD)
Proteins
| cytochrome b5-related, isoform A | |
|---|---|
| Refseq ID | NP_477154 |
| Protein GI | 17137186 |
| UniProt ID | P19967 |
| mRNA ID | NM_057806 |
| Length | 436 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:442628110 (mRNA isoform) | |
| cytochrome b5-related, isoform B | |
|---|---|
| Refseq ID | NP_001260514 |
| Protein GI | 442628110 |
| UniProt ID | P19967 |
| mRNA ID | NM_001273585 |
| Length | 436 |
| RefSeq Status | REVIEWED |
| MVIEEWKKSGIATKFPTYRNSALITTHSWQKGKRQDDGAEGLWRINDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTAPEKMIAKYKVRDAAEPRIYTLTLEEGGFYKTLKERVREQLKTIDKRPKKKSDLIHLGLVVSLYLLGIASAKYNSLLALVLASVALCWTVIVSHNYFHRRDNWQMYAFNLGMMNFAAWRVSHALSHHIYPNSYFDLELSMFEPLLCWVPNPHIKSKLMRYVSWVTEPVAYALAFFIQMGTRIFYSLRHTNILYWHDLLPLTIPIAIYLGTGGSLGIWICVRQWLAMTSIASFSFCLIGLNAAHHDPEIYHEGDANREDRDWGLFQVDTIIDRGDLKWSQFLVLTHFGDHVLHHLFPTLDHGLLPALYPVLYQTLDEFKGHLRECNHIEHMIGQHKQLLRIEPNPRAPGAGK | |
Gene Information
Entrez Gene ID
Gene Name
Cytochrome b5-related
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Contains 1 cytochrome b5 heme-binding domain. |
| Similarity | Contains cytochrome b5 heme-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008874 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 442628110 | RefSeq | NP_001260514 | 436 | cytochrome b5-related, isoform B |
Identical Sequences to LMP008874 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442628110 | GenBank | AAL13516.1 | 436 | GH03691p [Drosophila melanogaster] |
| GI:442628110 | GenBank | ACL85191.1 | 436 | Cyt-b5-r-PA, partial [synthetic construct] |
| GI:442628110 | GenBank | ACL90065.1 | 436 | Cyt-b5-r-PA [synthetic construct] |
| GI:442628110 | gnl | FlyBase | 436 | cytochrome b5-related, isoform B [Drosophila melanogaster] |
| GI:442628110 | RefSeq | NP_477154.1 | 436 | cytochrome b5-related, isoform A [Drosophila melanogaster] |
| GI:442628110 | SwissProt | P19967.2 | 436 | RecName: Full=Cytochrome b5-related protein; AltName: Full=Protein TU-36B [Drosophila melanogaster] |
Related Sequences to LMP008874 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442628110 | GenBank | EDW55505.1 | 436 | GM17157 [Drosophila sechellia] |
| GI:442628110 | GenBank | EDW90228.1 | 436 | GE13163 [Drosophila yakuba] |
| GI:442628110 | GenBank | EDX05262.1 | 436 | GD21896 [Drosophila simulans] |
| GI:442628110 | RefSeq | XP_002038859.1 | 436 | GM17157 [Drosophila sechellia] |
| GI:442628110 | RefSeq | XP_002090516.1 | 436 | GE13163 [Drosophila yakuba] |
| GI:442628110 | RefSeq | XP_002079677.1 | 436 | GD21896 [Drosophila simulans] |