Gene/Proteome Database (LMPD)

LMPD ID
LMP008874
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
Cytochrome b5-related
Gene Symbol
Synonyms
CG13279; Cyt-b; Cyt-b5; Cytb; Cytb5; Cytb5r; Dmel\CG13279; TU-36B; TU36B
Chromosome
2L
Map Location
36B1-36B1

Proteins

cytochrome b5-related, isoform A
Refseq ID NP_477154
Protein GI 17137186
UniProt ID P19967
mRNA ID NM_057806
Length 436
RefSeq Status REVIEWED
Protein sequence is identical to GI:442628110 (mRNA isoform)
cytochrome b5-related, isoform B
Refseq ID NP_001260514
Protein GI 442628110
UniProt ID P19967
mRNA ID NM_001273585
Length 436
RefSeq Status REVIEWED
MVIEEWKKSGIATKFPTYRNSALITTHSWQKGKRQDDGAEGLWRINDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTAPEKMIAKYKVRDAAEPRIYTLTLEEGGFYKTLKERVREQLKTIDKRPKKKSDLIHLGLVVSLYLLGIASAKYNSLLALVLASVALCWTVIVSHNYFHRRDNWQMYAFNLGMMNFAAWRVSHALSHHIYPNSYFDLELSMFEPLLCWVPNPHIKSKLMRYVSWVTEPVAYALAFFIQMGTRIFYSLRHTNILYWHDLLPLTIPIAIYLGTGGSLGIWICVRQWLAMTSIASFSFCLIGLNAAHHDPEIYHEGDANREDRDWGLFQVDTIIDRGDLKWSQFLVLTHFGDHVLHHLFPTLDHGLLPALYPVLYQTLDEFKGHLRECNHIEHMIGQHKQLLRIEPNPRAPGAGK

Gene Information

Entrez Gene ID
Gene Name
Cytochrome b5-related
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0006633 IEA:InterPro P fatty acid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR018506 Cytochrome b5, heme-binding site
IPR001199 Cytochrome b5-like heme/steroid binding domain
IPR005804 Fatty acid desaturase, type 1
IPR012171 Fatty acid/sphingolipid desaturase

UniProt Annotations

Entry Information

Gene Name
Cytochrome b5-related
Protein Entry
CYB5R_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Similarity Contains 1 cytochrome b5 heme-binding domain.
Similarity Contains cytochrome b5 heme-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP008874 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
442628110 RefSeq NP_001260514 436 cytochrome b5-related, isoform B

Identical Sequences to LMP008874 proteins

Reference Database Accession Length Protein Name
GI:442628110 GenBank AAL13516.1 436 GH03691p [Drosophila melanogaster]
GI:442628110 GenBank ACL85191.1 436 Cyt-b5-r-PA, partial [synthetic construct]
GI:442628110 GenBank ACL90065.1 436 Cyt-b5-r-PA [synthetic construct]
GI:442628110 gnl FlyBase 436 cytochrome b5-related, isoform B [Drosophila melanogaster]
GI:442628110 RefSeq NP_477154.1 436 cytochrome b5-related, isoform A [Drosophila melanogaster]
GI:442628110 SwissProt P19967.2 436 RecName: Full=Cytochrome b5-related protein; AltName: Full=Protein TU-36B [Drosophila melanogaster]

Related Sequences to LMP008874 proteins

Reference Database Accession Length Protein Name
GI:442628110 GenBank EDW55505.1 436 GM17157 [Drosophila sechellia]
GI:442628110 GenBank EDW90228.1 436 GE13163 [Drosophila yakuba]
GI:442628110 GenBank EDX05262.1 436 GD21896 [Drosophila simulans]
GI:442628110 RefSeq XP_002038859.1 436 GM17157 [Drosophila sechellia]
GI:442628110 RefSeq XP_002090516.1 436 GE13163 [Drosophila yakuba]
GI:442628110 RefSeq XP_002079677.1 436 GD21896 [Drosophila simulans]