Gene/Proteome Database (LMPD)
Proteins
| desaturase 2 | |
|---|---|
| Refseq ID | NP_650201 |
| Protein GI | 24646295 |
| UniProt ID | Q9VG68 |
| mRNA ID | NM_141944 |
| Length | 361 |
| RefSeq Status | REVIEWED |
| MAPYSRIYHQDKSSRETGVLFEDDAQTVDGDLTTDRFQLKRAEKRRLPLVWRNIILFALVHLAALYGLHSIFTRAKLATTLFAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLLLVIFNTIAFQDAVYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPDIKEKGRGLDLSDLRADPILMFQRKHYYILMPLACFVLPTVIPMVYWNETLASSWFVATMFRWCFQLNMTWLVNSAAHKFGNRPYDKTMNPTQNAFVSAFTFGEGWHNYHHAFPWDYKTAEWGCYSLNITTAFIDLFAKIGWAYDLKTVAPDVIQRRVLRTGDGSHELWGWGDKDLTAEDARNVLLVDKSR | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004768 | IEA:UniProtKB-EC | F | stearoyl-CoA 9-desaturase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Similarity | Belongs to the fatty acid desaturase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008883 (as displayed in Record Overview)
Identical Sequences to LMP008883 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24646295 | DBBJ | BAB21539.1 | 361 | fatty acid desaturase 2 [Drosophila melanogaster] |
| GI:24646295 | DBBJ | BAB21540.1 | 361 | fatty acid desaturase 2 [Drosophila melanogaster] |
| GI:24646295 | GenBank | ABC86489.1 | 361 | IP02593p [Drosophila melanogaster] |
| GI:24646295 | GenBank | ACL88709.1 | 361 | desat2-PA, partial [synthetic construct] |
| GI:24646295 | GenBank | ACL91946.1 | 361 | desat2-PA [synthetic construct] |
| GI:24646295 | gnl | FlyBase | 361 | desaturase 2 [Drosophila melanogaster] |
Related Sequences to LMP008883 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24646295 | DBBJ | BAB21537.1 | 361 | fatty acid desaturase 2 [Drosophila melanogaster] |
| GI:24646295 | EMBL | CAB69054.1 | 361 | fatty acid desaturase [Drosophila melanogaster] |
| GI:24646295 | GenBank | EDW42446.1 | 361 | GM24035 [Drosophila sechellia] |
| GI:24646295 | GenBank | EDX13202.1 | 361 | GD18836 [Drosophila simulans] |
| GI:24646295 | RefSeq | XP_002031460.1 | 361 | GM24035 [Drosophila sechellia] |
| GI:24646295 | RefSeq | XP_002103699.1 | 361 | GD18836 [Drosophila simulans] |