Gene/Proteome Database (LMPD)

LMPD ID
LMP008967
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
Heat shock gene 67Bc
Gene Symbol
Synonyms
CG4190; Dm-HSP67Bc; Dmel\CG4190; gene 3; gene-3; gene3; gene5; Hsp-G3; HSP67; hsp67B; Hsp67BC; HSP67Bc; HSPB8; Hspg3; small hsp locus 67B
Alternate Names
CG4190-PA; Hsp67Bc-PA; gene 3; heat shock gene 67Bc
Chromosome
3L
Map Location
67B2-67B2

Proteins

heat shock gene 67Bc
Refseq ID NP_523994
Protein GI 17647527
UniProt ID P22979
mRNA ID NM_079270
Length 199
RefSeq Status REVIEWED
MPDIPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARMGAHAHHLVANKRNGELAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASASEPEAK

Gene Information

Entrez Gene ID
Gene Name
Heat shock gene 67Bc
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0006497 IMP:FlyBase P protein lipidation
GO:0010506 IMP:FlyBase P regulation of autophagy
GO:0010998 IMP:FlyBase P regulation of translational initiation by eIF2 alpha phosphorylation
GO:0031427 IEP:FlyBase P response to methotrexate

REACTOME Pathway Links

REACTOME Pathway ID Description
6226745 AUF1 (hnRNP D0) destabilizes mRNA
6225926 Gene Expression
6226746 Regulation of mRNA stability by proteins that bind AU-rich elements
6226012 VEGFA-VEGFR2 Pathway

Domain Information

InterPro Annotations

Accession Description
IPR001436 Alpha crystallin/Heat shock protein
IPR002068 Alpha crystallin/Hsp20 domain
IPR008978 HSP20-like chaperone

UniProt Annotations

Entry Information

Gene Name
Heat shock gene 67Bc
Protein Entry
HSP6C_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Developmental Stage Expressed during embryogenesis and pupation.
Sequence Caution Sequence=CAA29788.1; Type=Frameshift; Positions=126, 180; Evidence={ECO:0000305};
Similarity Belongs to the small heat shock protein (HSP20) family. {ECO:0000255|PROSITE-ProRule:PRU00285}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008967 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17647527 RefSeq NP_523994 199 heat shock gene 67Bc

Identical Sequences to LMP008967 proteins

Reference Database Accession Length Protein Name
GI:17647527 GenBank AAY55705.1 199 IP02523p [Drosophila melanogaster]
GI:17647527 GenBank ACL88161.1 199 Hsp67Bc-PA, partial [synthetic construct]
GI:17647527 GenBank ACL92519.1 199 Hsp67Bc-PA [synthetic construct]
GI:17647527 gnl FlyBase 199 heat shock gene 67Bc [Drosophila melanogaster]
GI:17647527 SwissProt P22979.2 199 RecName: Full=Heat shock protein 67B3; AltName: Full=Heat shock 18 kDa protein [Drosophila melanogaster]

Related Sequences to LMP008967 proteins

Reference Database Accession Length Protein Name
GI:17647527 GenBank EDW40840.1 199 GM24882 [Drosophila sechellia]
GI:17647527 GenBank EDW93041.1 199 Hsp67Bc [Drosophila yakuba]
GI:17647527 GenBank EDX09829.1 199 GD12934 [Drosophila simulans]
GI:17647527 RefSeq XP_002029854.1 199 GM24882 [Drosophila sechellia]
GI:17647527 RefSeq XP_002093329.1 199 Hsp67Bc [Drosophila yakuba]
GI:17647527 RefSeq XP_002084244.1 199 GD12934 [Drosophila simulans]