Gene/Proteome Database (LMPD)
LMPD ID
LMP008967
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
Heat shock gene 67Bc
Gene Symbol
Synonyms
CG4190; Dm-HSP67Bc; Dmel\CG4190; gene 3; gene-3; gene3; gene5; Hsp-G3; HSP67; hsp67B; Hsp67BC; HSP67Bc; HSPB8; Hspg3; small hsp locus 67B
Alternate Names
CG4190-PA; Hsp67Bc-PA; gene 3; heat shock gene 67Bc
Chromosome
3L
Map Location
67B2-67B2
Proteins
| heat shock gene 67Bc | |
|---|---|
| Refseq ID | NP_523994 |
| Protein GI | 17647527 |
| UniProt ID | P22979 |
| mRNA ID | NM_079270 |
| Length | 199 |
| RefSeq Status | REVIEWED |
| MPDIPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARMGAHAHHLVANKRNGELAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASASEPEAK | |
Gene Information
Entrez Gene ID
Gene Name
Heat shock gene 67Bc
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0006497 | IMP:FlyBase | P | protein lipidation |
| GO:0010506 | IMP:FlyBase | P | regulation of autophagy |
| GO:0010998 | IMP:FlyBase | P | regulation of translational initiation by eIF2 alpha phosphorylation |
| GO:0031427 | IEP:FlyBase | P | response to methotrexate |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Expressed during embryogenesis and pupation. |
| Sequence Caution | Sequence=CAA29788.1; Type=Frameshift; Positions=126, 180; Evidence={ECO:0000305}; |
| Similarity | Belongs to the small heat shock protein (HSP20) family. {ECO:0000255|PROSITE-ProRule:PRU00285}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008967 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17647527 | RefSeq | NP_523994 | 199 | heat shock gene 67Bc |
Identical Sequences to LMP008967 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17647527 | GenBank | AAY55705.1 | 199 | IP02523p [Drosophila melanogaster] |
| GI:17647527 | GenBank | ACL88161.1 | 199 | Hsp67Bc-PA, partial [synthetic construct] |
| GI:17647527 | GenBank | ACL92519.1 | 199 | Hsp67Bc-PA [synthetic construct] |
| GI:17647527 | gnl | FlyBase | 199 | heat shock gene 67Bc [Drosophila melanogaster] |
| GI:17647527 | SwissProt | P22979.2 | 199 | RecName: Full=Heat shock protein 67B3; AltName: Full=Heat shock 18 kDa protein [Drosophila melanogaster] |
Related Sequences to LMP008967 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17647527 | GenBank | EDW40840.1 | 199 | GM24882 [Drosophila sechellia] |
| GI:17647527 | GenBank | EDW93041.1 | 199 | Hsp67Bc [Drosophila yakuba] |
| GI:17647527 | GenBank | EDX09829.1 | 199 | GD12934 [Drosophila simulans] |
| GI:17647527 | RefSeq | XP_002029854.1 | 199 | GM24882 [Drosophila sechellia] |
| GI:17647527 | RefSeq | XP_002093329.1 | 199 | Hsp67Bc [Drosophila yakuba] |
| GI:17647527 | RefSeq | XP_002084244.1 | 199 | GD12934 [Drosophila simulans] |