Gene/Proteome Database (LMPD)
Proteins
| isoprenylcysteine carboxylmethyltransferase, isoform A | |
|---|---|
| Refseq ID | NP_648623 |
| Protein GI | 21356091 |
| UniProt ID | Q9VU37 |
| mRNA ID | NM_140366 |
| Length | 299 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:442632077 (mRNA isoform) | |
| isoprenylcysteine carboxylmethyltransferase, isoform B | |
|---|---|
| Refseq ID | NP_001261793 |
| Protein GI | 442632077 |
| UniProt ID | Q9VU37 |
| mRNA ID | NM_001274864 |
| Length | 299 |
| RefSeq Status | REVIEWED |
| MCAKSRVASPGAGGTSLCSEGRISLYCFLITAALVLIPSVPQNLYGVVPQVWGAVLWGPFLYYALINMIIRFVLRNHDYQVAIRASFLGFAMAVSVLVICFAPTEWQQFGAYGCFMSLFHYSEFLVIAFANPRTLSLDSFMLNHSVHYGLAAAASWIEFSLEVYYLPQFKRYGYIWVAGVVLCLLGEMVRKAAIITAGRSFTHLVQNEKHSEHKLITSGIYAYCRHPSYVGWFWWSIGTQIVLLNPICICIYTLVSWLFFHDRIYVEEYSLLNFFQSDYVRYQKRVPTGLPFIRGYLVD | |
Gene Information
Entrez Gene ID
Gene Name
isoprenylcysteine carboxylmethyltransferase
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:InterPro | C | endoplasmic reticulum |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0004671 | IEA:UniProtKB-EC | F | protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
isoprenylcysteine carboxylmethyltransferase
Protein Entry
Q9VU37_DROME
UniProt ID
Species
Drosophila
Identical and Related Proteins
Unique RefSeq proteins for LMP008991 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 442632077 | RefSeq | NP_001261793 | 299 | isoprenylcysteine carboxylmethyltransferase, isoform B |
Identical Sequences to LMP008991 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442632077 | GenBank | AAL48171.1 | 299 | RH37735p [Drosophila melanogaster] |
| GI:442632077 | GenBank | AAL48625.1 | 299 | RE09034p [Drosophila melanogaster] |
| GI:442632077 | GenBank | ACL87200.1 | 299 | CG11268-PA, partial [synthetic construct] |
| GI:442632077 | GenBank | ACL91815.1 | 299 | CG11268-PA [synthetic construct] |
| GI:442632077 | gnl | FlyBase | 299 | isoprenylcysteine carboxylmethyltransferase, isoform B [Drosophila melanogaster] |
| GI:442632077 | RefSeq | NP_648623.1 | 299 | isoprenylcysteine carboxylmethyltransferase, isoform A [Drosophila melanogaster] |
Related Sequences to LMP008991 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442632077 | GenBank | EDV51639.1 | 299 | GG15617 [Drosophila erecta] |
| GI:442632077 | GenBank | EDW41342.1 | 299 | GM25390 [Drosophila sechellia] |
| GI:442632077 | GenBank | EDX10315.1 | 299 | GD14422 [Drosophila simulans] |
| GI:442632077 | RefSeq | XP_001972613.1 | 299 | GG15617 [Drosophila erecta] |
| GI:442632077 | RefSeq | XP_002030356.1 | 299 | GM25390 [Drosophila sechellia] |
| GI:442632077 | RefSeq | XP_002084730.1 | 299 | GD14422 [Drosophila simulans] |