Gene/Proteome Database (LMPD)
Proteins
nessy, isoform A | |
---|---|
Refseq ID | NP_524157 |
Protein GI | 24666648 |
UniProt ID | Q9VVX5 |
mRNA ID | NM_079433 |
Length | 497 |
RefSeq Status | REVIEWED |
MAEFEEDLPHNGLMDGIASGVGVPVEALRLLLTILAGYPVAALYQKFISVIADKTVHHMFFAGCGAGLCYFNYGLDTYHSLIAILTTYFLVLLLRKKTQIFLAINFVFHMSYLLLGYFYTSSNDYDILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETALKKPPSLLELLAFSYFPSGFLVGPQFPFRRYKAFVDGEFRQHEGNVEAGVRRFGAGAFYLIVCQVGLRYLPDSYFLTPEFAQVSFVKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGCSNVKLKLLETGNTMEHYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFLAVWHGYHSGYYMTFLMEYMVVSTEKQITRFYTKVVLPQWGHILNNSDIYKLLYFITLKSYNVVYMGWCLTAFVFLKYERWIVVYGAVSYYGFTFLVLWAAFYHTFNHFFRSSSRKLAGEDQKLQDSNTDKLVEEKKPEDKKSE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | NAS:UniProtKB | C | integral component of membrane |
GO:0016020 | IDA:FlyBase | C | membrane |
GO:0047184 | IEA:UniProtKB-EC | F | 1-acylglycerophosphocholine O-acyltransferase activity |
GO:0071617 | IDA:FlyBase | F | lysophospholipid acyltransferase activity |
GO:0008354 | IGI:FlyBase | P | germ cell migration |
GO:0030258 | IMP:FlyBase | P | lipid modification |
GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
GO:0007009 | IGI:FlyBase | P | plasma membrane organization |
GO:0007291 | IGI:FlyBase | P | sperm individualization |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR004299 | Membrane bound O-acyl transferase, MBOAT |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphatidylserine = CoA + 1,2-diacyl-sn-glycero-3- phosphatidylserine. |
Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine. |
Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphoethanolamine = CoA + 1,2-diacyl-sn-glycero-3- phosphoethanolamine. |
Caution | Although strongly related to the membrane-bound acyltransferase family, it lacks the conserved His active site which is replaced by an Asn-415 residue. |
Developmental Stage | Expressed throughout development with highest levels in adult females and preblastoderm embryos. |
Function | Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) to phosphatidylcholine (1,2-diacyl-sn-glycero-3- phosphocholine or PC) (LPCAT activity). May also catalyze the conversion of lysophosphatidylethanolamine (1-acyl-2-hydroxy-sn- glycero-3-phosphoethanolamine or LPE) to phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity), as well as the conversion of lysophosphatidylserine (1- acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) to phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has a preference for unsaturated fatty acids such as arachidonic acid. |
Pathway | Lipid metabolism; phospholipid metabolism. |
Similarity | Belongs to the membrane-bound acyltransferase family. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Tissue Specificity | During gastrulation, expressed mainly along the midline in the presumptive mesoderm. During germ band elongation, expressed in mesoderm and endoderm primordia and in the cephalic furrow. Expression in mesoderm and endoderm lineages continues during germ band shortening. At the end of this process, no longer detected in somatic mesoderm or endoderm layer with expression restricted to anterior and posterior domains of the visceral mesoderm. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009032 (as displayed in Record Overview)
Identical Sequences to LMP009032 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24666648 | GenBank | ACL86398.1 | 497 | nes-PA, partial [synthetic construct] |
GI:24666648 | GenBank | ACL91051.1 | 497 | nes-PA [synthetic construct] |
GI:24666648 | GenBank | ADM04701.1 | 497 | Sequence 39 from patent US 7732155 |
GI:24666648 | GenBank | ADM04725.1 | 497 | Sequence 63 from patent US 7732155 |
GI:24666648 | GenBank | AGM70839.1 | 497 | Sequence 39 from patent US 8383886 |
GI:24666648 | GenBank | AGM70863.1 | 497 | Sequence 63 from patent US 8383886 |
Related Sequences to LMP009032 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24666648 | GenBank | AAD28257.1 | 497 | putative transmembrane protein nessy [Drosophila melanogaster] |
GI:24666648 | GenBank | EDW46594.1 | 496 | GM14886 [Drosophila sechellia] |
GI:24666648 | GenBank | EDW99739.1 | 497 | GE22919 [Drosophila yakuba] |
GI:24666648 | RefSeq | XP_002042667.1 | 496 | GM14886 [Drosophila sechellia] |
GI:24666648 | RefSeq | XP_002086338.1 | 497 | GE22919 [Drosophila yakuba] |
GI:24666648 | RefSeq | XP_002095640.1 | 497 | GE22515 [Drosophila yakuba] |