Gene/Proteome Database (LMPD)

LMPD ID
LMP009032
Gene ID
40093
Species
Drosophila melanogaster (Drosophila)
Gene Name
nessy
Gene Symbol
nes
Synonyms
CG9655; Dmel\CG9655; Nes
Chromosome
3L
Map Location
76A3-76A3

Proteins

nessy, isoform A
Refseq ID NP_524157
Protein GI 24666648
UniProt ID Q9VVX5
mRNA ID NM_079433
Length 497
RefSeq Status REVIEWED
MAEFEEDLPHNGLMDGIASGVGVPVEALRLLLTILAGYPVAALYQKFISVIADKTVHHMFFAGCGAGLCYFNYGLDTYHSLIAILTTYFLVLLLRKKTQIFLAINFVFHMSYLLLGYFYTSSNDYDILWTMPHCILVLRMIGYGFDITDGLKEESELSKDQKETALKKPPSLLELLAFSYFPSGFLVGPQFPFRRYKAFVDGEFRQHEGNVEAGVRRFGAGAFYLIVCQVGLRYLPDSYFLTPEFAQVSFVKRIYLLGFWAKFSLYKYISCWLLTEGALICIGLTYKGEDKNGQPDWSGCSNVKLKLLETGNTMEHYVQSFNVNTNQWVGQYIYKRLKFLNNRTISYGAALGFLAVWHGYHSGYYMTFLMEYMVVSTEKQITRFYTKVVLPQWGHILNNSDIYKLLYFITLKSYNVVYMGWCLTAFVFLKYERWIVVYGAVSYYGFTFLVLWAAFYHTFNHFFRSSSRKLAGEDQKLQDSNTDKLVEEKKPEDKKSE
nessy, isoform B
Refseq ID NP_730390
Protein GI 24666652
UniProt ID Q9VVX5
mRNA ID NM_168788
Length 497
RefSeq Status REVIEWED
Protein sequence is identical to GI:24666648 (mRNA isoform)
nessy, isoform C
Refseq ID NP_788527
Protein GI 28574854
UniProt ID Q9VVX5
mRNA ID NM_176349
Length 497
RefSeq Status REVIEWED
Protein sequence is identical to GI:24666648 (mRNA isoform)

Gene Information

Entrez Gene ID
40093
Gene Name
nessy
Gene Symbol
nes
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 NAS:UniProtKB C integral component of membrane
GO:0016020 IDA:FlyBase C membrane
GO:0047184 IEA:UniProtKB-EC F 1-acylglycerophosphocholine O-acyltransferase activity
GO:0071617 IDA:FlyBase F lysophospholipid acyltransferase activity
GO:0008354 IGI:FlyBase P germ cell migration
GO:0030258 IMP:FlyBase P lipid modification
GO:0008654 IEA:UniProtKB-KW P phospholipid biosynthetic process
GO:0007009 IGI:FlyBase P plasma membrane organization
GO:0007291 IGI:FlyBase P sperm individualization

Domain Information

InterPro Annotations

Accession Description
IPR004299 Membrane bound O-acyl transferase, MBOAT

UniProt Annotations

Entry Information

Gene Name
nessy
Protein Entry
Q9VVX5_DROME
UniProt ID
Q9VVX5
Species
Drosophila

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3- phosphatidylserine = CoA + 1,2-diacyl-sn-glycero-3- phosphatidylserine.
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3- phosphoethanolamine = CoA + 1,2-diacyl-sn-glycero-3- phosphoethanolamine.
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycero-3-phosphocholine = CoA + 1,2-diacyl-sn-glycero-3-phosphocholine.
Caution Although strongly related to the membrane-bound acyltransferase family, it lacks the conserved His active site which is replaced by an Asn-415 residue.
Developmental Stage Expressed throughout development with highest levels in adult females and preblastoderm embryos.
Function Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) to phosphatidylcholine (1,2-diacyl-sn-glycero-3- phosphocholine or PC) (LPCAT activity). May also catalyze the conversion of lysophosphatidylethanolamine (1-acyl-2-hydroxy-sn- glycero-3-phosphoethanolamine or LPE) to phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity), as well as the conversion of lysophosphatidylserine (1- acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) to phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has a preference for unsaturated fatty acids such as arachidonic acid.
Pathway Lipid metabolism; phospholipid metabolism.
Similarity Belongs to the membrane-bound acyltransferase family.
Subcellular Location Membrane ; Multi-pass membrane protein .
Tissue Specificity During gastrulation, expressed mainly along the midline in the presumptive mesoderm. During germ band elongation, expressed in mesoderm and endoderm primordia and in the cephalic furrow. Expression in mesoderm and endoderm lineages continues during germ band shortening. At the end of this process, no longer detected in somatic mesoderm or endoderm layer with expression restricted to anterior and posterior domains of the visceral mesoderm.

Identical and Related Proteins

Unique RefSeq proteins for LMP009032 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
24666648 RefSeq NP_524157 497 nessy, isoform A

Identical Sequences to LMP009032 proteins

Reference Database Accession Length Protein Name
GI:24666648 GenBank ACL86398.1 497 nes-PA, partial [synthetic construct]
GI:24666648 GenBank ACL91051.1 497 nes-PA [synthetic construct]
GI:24666648 GenBank ADM04701.1 497 Sequence 39 from patent US 7732155
GI:24666648 GenBank ADM04725.1 497 Sequence 63 from patent US 7732155
GI:24666648 GenBank AGM70839.1 497 Sequence 39 from patent US 8383886
GI:24666648 GenBank AGM70863.1 497 Sequence 63 from patent US 8383886

Related Sequences to LMP009032 proteins

Reference Database Accession Length Protein Name
GI:24666648 GenBank AAD28257.1 497 putative transmembrane protein nessy [Drosophila melanogaster]
GI:24666648 GenBank EDW46594.1 496 GM14886 [Drosophila sechellia]
GI:24666648 GenBank EDW99739.1 497 GE22919 [Drosophila yakuba]
GI:24666648 RefSeq XP_002042667.1 496 GM14886 [Drosophila sechellia]
GI:24666648 RefSeq XP_002086338.1 497 GE22919 [Drosophila yakuba]
GI:24666648 RefSeq XP_002095640.1 497 GE22515 [Drosophila yakuba]