Gene/Proteome Database (LMPD)

LMPD ID
LMP009033
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
Palmitoyl-protein Thioesterase 2
Gene Symbol
Synonyms
CG4851; Dmel\CG4851; PPT-2
Alternate Names
CG4851-PA; Palmitoyl-protein thioesterase 2; Ppt2-PA
Chromosome
2L
Map Location
32E2-32E2
EC Number
3.1.2.-

Proteins

Palmitoyl-protein thioesterase 2
Refseq ID NP_609500
Protein GI 20129455
UniProt ID Q9VKH6
mRNA ID NM_135656
Length 288
RefSeq Status REVIEWED
MRLRLQVLVALLTCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDKFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLKYSEFLPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRRPIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD

Gene Information

Entrez Gene ID
Gene Name
Palmitoyl-protein Thioesterase 2
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005764 IDA:UniProtKB C lysosome
GO:0008474 ISS:UniProtKB F palmitoyl-(protein) hydrolase activity
GO:0002084 IGI:FlyBase P protein depalmitoylation

KEGG Pathway Links

KEGG Pathway ID Description
dme00062 Fatty acid elongation
dme01212 Fatty acid metabolism
dme04142 Lysosome
dme01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR002472 Palmitoyl protein thioesterase

UniProt Annotations

Entry Information

Gene Name
Palmitoyl-protein Thioesterase 2
Protein Entry
PPT2_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Developmental Stage Low level expression is detected in embryonic development with no distinct tissue specific enrichment. Expression levels increase at third larval instar stage and continue through to adulthood. {ECO:0000269|PubMed:18719403}.
Function Probable thioesterase removing fatty acyl groups from various substrates such as S-palmitoyl-CoA. Because of structural constraints, may be unable to remove palmitate from peptides or proteins (By similarity). {ECO:0000250}.
Sequence Caution Sequence=AAL28270.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the palmitoyl-protein thioesterase family. {ECO:0000305}.
Subcellular Location Lysosome {ECO:0000269|PubMed:18719403}.
Tissue Specificity Expressed in adult head and crop. {ECO:0000269|PubMed:18719403}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009033 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20129455 RefSeq NP_609500 288 Palmitoyl-protein thioesterase 2

Identical Sequences to LMP009033 proteins

Reference Database Accession Length Protein Name
GI:20129455 GenBank AAX33594.1 288 GH02317p [Drosophila melanogaster]
GI:20129455 GenBank ACL88313.1 288 Ppt2-PA, partial [synthetic construct]
GI:20129455 GenBank ACL92410.1 288 Ppt2-PA [synthetic construct]
GI:20129455 gnl FlyBase 288 Palmitoyl-protein thioesterase 2 [Drosophila melanogaster]
GI:20129455 SwissProt Q9VKH6.1 288 RecName: Full=Lysosomal thioesterase PPT2 homolog; Short=PPT-2; Flags: Precursor [Drosophila melanogaster]

Related Sequences to LMP009033 proteins

Reference Database Accession Length Protein Name
GI:20129455 GenBank EDV58903.1 288 GG23717 [Drosophila erecta]
GI:20129455 GenBank EDW52582.1 288 GM18996 [Drosophila sechellia]
GI:20129455 GenBank EDX04688.1 288 GD23774 [Drosophila simulans]
GI:20129455 RefSeq XP_001969844.1 288 GG23717 [Drosophila erecta]
GI:20129455 RefSeq XP_002036659.1 288 GM18996 [Drosophila sechellia]
GI:20129455 RefSeq XP_002079103.1 288 GD23774 [Drosophila simulans]