Gene/Proteome Database (LMPD)
Proteins
Palmitoyl-protein thioesterase 2 | |
---|---|
Refseq ID | NP_609500 |
Protein GI | 20129455 |
UniProt ID | Q9VKH6 |
mRNA ID | NM_135656 |
Length | 288 |
RefSeq Status | REVIEWED |
MRLRLQVLVALLTCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDKFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLKYSEFLPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRRPIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD |
Gene Information
Entrez Gene ID
Gene Name
Palmitoyl-protein Thioesterase 2
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005764 | IDA:UniProtKB | C | lysosome |
GO:0008474 | ISS:UniProtKB | F | palmitoyl-(protein) hydrolase activity |
GO:0002084 | IGI:FlyBase | P | protein depalmitoylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
Palmitoyl-protein Thioesterase 2
Protein Entry
PPT2_DROME
UniProt ID
Species
Drosophila
Comments
Comment Type | Description |
---|---|
Developmental Stage | Low level expression is detected in embryonic development with no distinct tissue specific enrichment. Expression levels increase at third larval instar stage and continue through to adulthood. {ECO:0000269|PubMed:18719403}. |
Function | Probable thioesterase removing fatty acyl groups from various substrates such as S-palmitoyl-CoA. Because of structural constraints, may be unable to remove palmitate from peptides or proteins (By similarity). {ECO:0000250}. |
Sequence Caution | Sequence=AAL28270.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Belongs to the palmitoyl-protein thioesterase family. {ECO:0000305}. |
Subcellular Location | Lysosome {ECO:0000269|PubMed:18719403}. |
Tissue Specificity | Expressed in adult head and crop. {ECO:0000269|PubMed:18719403}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009033 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
20129455 | RefSeq | NP_609500 | 288 | Palmitoyl-protein thioesterase 2 |
Identical Sequences to LMP009033 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:20129455 | GenBank | AAX33594.1 | 288 | GH02317p [Drosophila melanogaster] |
GI:20129455 | GenBank | ACL88313.1 | 288 | Ppt2-PA, partial [synthetic construct] |
GI:20129455 | GenBank | ACL92410.1 | 288 | Ppt2-PA [synthetic construct] |
GI:20129455 | gnl | FlyBase | 288 | Palmitoyl-protein thioesterase 2 [Drosophila melanogaster] |
GI:20129455 | SwissProt | Q9VKH6.1 | 288 | RecName: Full=Lysosomal thioesterase PPT2 homolog; Short=PPT-2; Flags: Precursor [Drosophila melanogaster] |
Related Sequences to LMP009033 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:20129455 | GenBank | EDV58903.1 | 288 | GG23717 [Drosophila erecta] |
GI:20129455 | GenBank | EDW52582.1 | 288 | GM18996 [Drosophila sechellia] |
GI:20129455 | GenBank | EDX04688.1 | 288 | GD23774 [Drosophila simulans] |
GI:20129455 | RefSeq | XP_001969844.1 | 288 | GG23717 [Drosophila erecta] |
GI:20129455 | RefSeq | XP_002036659.1 | 288 | GM18996 [Drosophila sechellia] |
GI:20129455 | RefSeq | XP_002079103.1 | 288 | GD23774 [Drosophila simulans] |