Gene/Proteome Database (LMPD)

LMPD ID
LMP009071
Gene ID
42367
Species
Drosophila melanogaster (Drosophila)
Gene Name
neither inactivation nor afterpotential E
Gene Symbol
ninaE
Synonyms
143283_at; 1F9; BEST:GH11778; CG4550; Dm Rh1; DMELRH1; Dmel\CG4550; DmRh1; DRh1; FBgn0002940; Nina E; NinaE; opsin; ora; R; Rh; Rh-1; rh1; Rh1; RH1; Rh1(ninaE); rh1/ninaE; Rh1/ninaE; rhodopsin; Rhodopsin-1
Alternate Names
CG4550-PA; neither inactivation nor afterpotential E; ninaE-PA; rhodopsin; rhodopsin 1; rhodopsin-1; rhodopsin1
Chromosome
3R
Map Location
92B4-92B4

Proteins

neither inactivation nor afterpotential E
Refseq ID NP_524407
Protein GI 17738051
UniProt ID P06002
mRNA ID NM_079683
Length 373
RefSeq Status REVIEWED
MESFAVAAAQLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASEAESKA

Gene Information

Entrez Gene ID
42367
Gene Name
neither inactivation nor afterpotential E
Gene Symbol
ninaE
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016023 IDA:FlyBase C cytoplasmic membrane-bounded vesicle
GO:0016027 IPI:FlyBase C inaD signaling complex
GO:0016021 ISS:FlyBase C integral component of membrane
GO:0005771 IDA:FlyBase C multivesicular body
GO:0005886 IDA:FlyBase C plasma membrane
GO:0016028 IDA:FlyBase C rhabdomere
GO:0005791 IDA:FlyBase C rough endoplasmic reticulum
GO:0005767 IDA:FlyBase C secondary lysosome
GO:0016029 IDA:FlyBase C subrhabdomeral cisterna
GO:0008020 IMP:FlyBase F G-protein coupled photoreceptor activity
GO:0007186 ISS:FlyBase P G-protein coupled receptor signaling pathway
GO:0008344 IMP:FlyBase P adult locomotory behavior
GO:0009589 IMP:FlyBase P detection of UV
GO:0009584 IMP:FlyBase P detection of visible light
GO:0046673 IMP:FlyBase P negative regulation of compound eye retinal cell programmed cell death
GO:0071632 IMP:FlyBase P optomotor response
GO:0030265 IMP:FlyBase P phospholipase C-activating rhodopsin mediated signaling pathway
GO:0008594 IMP:FlyBase P photoreceptor cell morphogenesis
GO:0042331 IMP:FlyBase P phototaxis
GO:0007602 IMP:FlyBase P phototransduction
GO:0018298 IEA:UniProtKB-KW P protein-chromophore linkage
GO:0009642 IMP:FlyBase P response to light intensity
GO:0042052 IMP:FlyBase P rhabdomere development
GO:0043052 IMP:FlyBase P thermotaxis
GO:0007601 IEA:UniProtKB-KW P visual perception

KEGG Pathway Links

KEGG Pathway ID Description
dme04745 Phototransduction - fly
ko04745 Phototransduction - fly

REACTOME Pathway Links

REACTOME Pathway ID Description
6226646 Class A/1 (Rhodopsin-like receptors)
6226688 Opsins

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR001760 Opsin
IPR001735 Opsin RH1/RH2
IPR027430 Visual pigments (opsins) retinal binding site

UniProt Annotations

Entry Information

Gene Name
neither inactivation nor afterpotential E
Protein Entry
OPS1_DROME
UniProt ID
P06002
Species
Drosophila

Comments

Comment Type Description
Biophysicochemical Properties Absorption: Abs(max)=480 nm;
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Miscellaneous Each Drosophila eye is composed of 800 facets or ommatidia. Each ommatidium contains 8 photoreceptor cells (R1-R8), the R1 to R6 cells are outer cells, while R7 and R8 are inner cells.
Ptm Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region.
Similarity Belongs to the G-protein coupled receptor 1 family. Opsin subfamily. {ECO:0000255|PROSITE-ProRule:PRU00521}.
Subcellular Location Membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP009071 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17738051 RefSeq NP_524407 373 neither inactivation nor afterpotential E

Identical Sequences to LMP009071 proteins

Reference Database Accession Length Protein Name
GI:17738051 GenBank AAY85114.1 373 GH24720p [Drosophila melanogaster]
GI:17738051 GenBank ABK30914.1 373 IP09935p [Drosophila melanogaster]
GI:17738051 GenBank EDV48447.1 373 ninaE [Drosophila erecta]
GI:17738051 GenBank ACL88112.1 373 ninaE-PA, partial [synthetic construct]
GI:17738051 GenBank ACL92362.1 373 ninaE-PA [synthetic construct]
GI:17738051 RefSeq XP_001979489.1 373 ninaE [Drosophila erecta]

Related Sequences to LMP009071 proteins

Reference Database Accession Length Protein Name
GI:17738051 GenBank EDW49428.1 373 GM26888 [Drosophila sechellia]
GI:17738051 GenBank EDW96074.1 373 GE25107 [Drosophila yakuba]
GI:17738051 GenBank EDX12291.1 373 GD20095 [Drosophila simulans]
GI:17738051 RefSeq XP_002043271.1 373 GM26888 [Drosophila sechellia]
GI:17738051 RefSeq XP_002096362.1 373 GE25107 [Drosophila yakuba]
GI:17738051 RefSeq XP_002102788.1 373 GD20095 [Drosophila simulans]