Gene/Proteome Database (LMPD)
LMPD ID
LMP009071
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
neither inactivation nor afterpotential E
Gene Symbol
Synonyms
143283_at; 1F9; BEST:GH11778; CG4550; Dm Rh1; DMELRH1; Dmel\CG4550; DmRh1; DRh1; FBgn0002940; Nina E; NinaE; opsin; ora; R; Rh; Rh-1; rh1; Rh1; RH1; Rh1(ninaE); rh1/ninaE; Rh1/ninaE; rhodopsin; Rhodopsin-1
Alternate Names
CG4550-PA; neither inactivation nor afterpotential E; ninaE-PA; rhodopsin; rhodopsin 1; rhodopsin-1; rhodopsin1
Chromosome
3R
Map Location
92B4-92B4
Proteins
| neither inactivation nor afterpotential E | |
|---|---|
| Refseq ID | NP_524407 |
| Protein GI | 17738051 |
| UniProt ID | P06002 |
| mRNA ID | NM_079683 |
| Length | 373 |
| RefSeq Status | REVIEWED |
| MESFAVAAAQLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASEAESKA | |
Gene Information
Entrez Gene ID
Gene Name
neither inactivation nor afterpotential E
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016023 | IDA:FlyBase | C | cytoplasmic membrane-bounded vesicle |
| GO:0016027 | IPI:FlyBase | C | inaD signaling complex |
| GO:0016021 | ISS:FlyBase | C | integral component of membrane |
| GO:0005771 | IDA:FlyBase | C | multivesicular body |
| GO:0005886 | IDA:FlyBase | C | plasma membrane |
| GO:0016028 | IDA:FlyBase | C | rhabdomere |
| GO:0005791 | IDA:FlyBase | C | rough endoplasmic reticulum |
| GO:0005767 | IDA:FlyBase | C | secondary lysosome |
| GO:0016029 | IDA:FlyBase | C | subrhabdomeral cisterna |
| GO:0008020 | IMP:FlyBase | F | G-protein coupled photoreceptor activity |
| GO:0007186 | ISS:FlyBase | P | G-protein coupled receptor signaling pathway |
| GO:0008344 | IMP:FlyBase | P | adult locomotory behavior |
| GO:0009589 | IMP:FlyBase | P | detection of UV |
| GO:0009584 | IMP:FlyBase | P | detection of visible light |
| GO:0046673 | IMP:FlyBase | P | negative regulation of compound eye retinal cell programmed cell death |
| GO:0071632 | IMP:FlyBase | P | optomotor response |
| GO:0030265 | IMP:FlyBase | P | phospholipase C-activating rhodopsin mediated signaling pathway |
| GO:0008594 | IMP:FlyBase | P | photoreceptor cell morphogenesis |
| GO:0042331 | IMP:FlyBase | P | phototaxis |
| GO:0007602 | IMP:FlyBase | P | phototransduction |
| GO:0018298 | IEA:UniProtKB-KW | P | protein-chromophore linkage |
| GO:0009642 | IMP:FlyBase | P | response to light intensity |
| GO:0042052 | IMP:FlyBase | P | rhabdomere development |
| GO:0043052 | IMP:FlyBase | P | thermotaxis |
| GO:0007601 | IEA:UniProtKB-KW | P | visual perception |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
neither inactivation nor afterpotential E
Protein Entry
OPS1_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Absorption: Abs(max)=480 nm; |
| Function | Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. |
| Miscellaneous | Each Drosophila eye is composed of 800 facets or ommatidia. Each ommatidium contains 8 photoreceptor cells (R1-R8), the R1 to R6 cells are outer cells, while R7 and R8 are inner cells. |
| Ptm | Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. Opsin subfamily. {ECO:0000255|PROSITE-ProRule:PRU00521}. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009071 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17738051 | RefSeq | NP_524407 | 373 | neither inactivation nor afterpotential E |
Identical Sequences to LMP009071 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17738051 | GenBank | AAY85114.1 | 373 | GH24720p [Drosophila melanogaster] |
| GI:17738051 | GenBank | ABK30914.1 | 373 | IP09935p [Drosophila melanogaster] |
| GI:17738051 | GenBank | EDV48447.1 | 373 | ninaE [Drosophila erecta] |
| GI:17738051 | GenBank | ACL88112.1 | 373 | ninaE-PA, partial [synthetic construct] |
| GI:17738051 | GenBank | ACL92362.1 | 373 | ninaE-PA [synthetic construct] |
| GI:17738051 | RefSeq | XP_001979489.1 | 373 | ninaE [Drosophila erecta] |
Related Sequences to LMP009071 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17738051 | GenBank | EDW49428.1 | 373 | GM26888 [Drosophila sechellia] |
| GI:17738051 | GenBank | EDW96074.1 | 373 | GE25107 [Drosophila yakuba] |
| GI:17738051 | GenBank | EDX12291.1 | 373 | GD20095 [Drosophila simulans] |
| GI:17738051 | RefSeq | XP_002043271.1 | 373 | GM26888 [Drosophila sechellia] |
| GI:17738051 | RefSeq | XP_002096362.1 | 373 | GE25107 [Drosophila yakuba] |
| GI:17738051 | RefSeq | XP_002102788.1 | 373 | GD20095 [Drosophila simulans] |