Gene/Proteome Database (LMPD)
Proteins
| CG18810 | |
|---|---|
| Refseq ID | NP_652670 |
| Protein GI | 45550896 |
| UniProt ID | Q9I7L7 |
| mRNA ID | NM_144413 |
| Length | 300 |
| RefSeq Status | REVIEWED |
| MRFRSLKNIWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGFDLDPDNERVADWCSETTIKDG | |
Gene Information
Entrez Gene ID
Gene Name
CG18810 gene product from transcript CG18810-RA
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:FlyBase | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG18810 gene product from transcript CG18810-RA
Protein Entry
Q9I7L7_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009090 (as displayed in Record Overview)
Identical Sequences to LMP009090 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45550896 | GenBank | ABV82134.1 | 300 | AT08088p [Drosophila melanogaster] |
| GI:45550896 | gnl | FlyBase | 300 | CG18810 [Drosophila melanogaster] |
Related Sequences to LMP009090 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45550896 | GenBank | EDW46362.1 | 300 | GM23360 [Drosophila sechellia] |
| GI:45550896 | GenBank | EDW90537.1 | 291 | GE13316 [Drosophila yakuba] |
| GI:45550896 | GenBank | EDX05638.1 | 300 | GD24271 [Drosophila simulans] |
| GI:45550896 | RefSeq | XP_002042450.1 | 300 | GM23360 [Drosophila sechellia] |
| GI:45550896 | RefSeq | XP_002090825.1 | 291 | GE13316 [Drosophila yakuba] |
| GI:45550896 | RefSeq | XP_002080053.1 | 300 | GD24271 [Drosophila simulans] |