Gene/Proteome Database (LMPD)
Proteins
CG18810 | |
---|---|
Refseq ID | NP_652670 |
Protein GI | 45550896 |
UniProt ID | Q9I7L7 |
mRNA ID | NM_144413 |
Length | 300 |
RefSeq Status | REVIEWED |
MRFRSLKNIWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGFDLDPDNERVADWCSETTIKDG |
Gene Information
Entrez Gene ID
Gene Name
CG18810 gene product from transcript CG18810-RA
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IDA:FlyBase | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG18810 gene product from transcript CG18810-RA
Protein Entry
Q9I7L7_DROME
UniProt ID
Species
Drosophila
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Similarity | Belongs to the DHHC palmitoyltransferase family. |
Similarity | Contains 1 DHHC-type zinc finger. |
Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009090 (as displayed in Record Overview)
Identical Sequences to LMP009090 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:45550896 | GenBank | ABV82134.1 | 300 | AT08088p [Drosophila melanogaster] |
GI:45550896 | gnl | FlyBase | 300 | CG18810 [Drosophila melanogaster] |
Related Sequences to LMP009090 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:45550896 | GenBank | EDW46362.1 | 300 | GM23360 [Drosophila sechellia] |
GI:45550896 | GenBank | EDW90537.1 | 291 | GE13316 [Drosophila yakuba] |
GI:45550896 | GenBank | EDX05638.1 | 300 | GD24271 [Drosophila simulans] |
GI:45550896 | RefSeq | XP_002042450.1 | 300 | GM23360 [Drosophila sechellia] |
GI:45550896 | RefSeq | XP_002090825.1 | 291 | GE13316 [Drosophila yakuba] |
GI:45550896 | RefSeq | XP_002080053.1 | 300 | GD24271 [Drosophila simulans] |