Gene/Proteome Database (LMPD)

LMPD ID
LMP009132
Gene ID
33374
Species
Drosophila melanogaster (Drosophila)
Gene Name
Niemann-Pick type C-2a
Gene Symbol
Npc2a
Synonyms
BcDNA:GH22047; BcDNA:RH53228; BEST:GH08376; CG7291; CT22505; Dmel\CG7291; DmML3; dnpc2a; NPC2; npc2a
Alternate Names
CG7291-PA; Niemann-Pick type C-2; Niemann-Pick type C-2a; Npc2a-PA; epididymal secretory protein
Chromosome
2L
Map Location
22B8-22B8

Proteins

Niemann-Pick type C-2a
Refseq ID NP_608637
Protein GI 20129163
UniProt ID Q9VQ62
mRNA ID NM_134793
Length 148
RefSeq Status REVIEWED
MLRYAVIACAALVVFAGALEFSDCGSKTGKFTRVAIEGCDTTKAECILKRNTTVSFSIDFALAEEATAVKTVVHGKVLGIEMPFPLANPDACVDSGLKCPLEKDESYRYTATLPVLRSYPKVSVLVKWELQDQDGADIICVEIPAKIQ

Gene Information

Entrez Gene ID
33374
Gene Name
Niemann-Pick type C-2a
Gene Symbol
Npc2a
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IDA:FlyBase C extracellular space
GO:0030882 IDA:FlyBase F lipid antigen binding
GO:0001530 IDA:FlyBase F lipopolysaccharide binding
GO:0070891 IDA:FlyBase F lipoteichoic acid binding
GO:0042834 IDA:FlyBase F peptidoglycan binding
GO:0045456 IGI:FlyBase P ecdysteroid biosynthetic process
GO:0061057 IMP:FlyBase P peptidoglycan recognition protein signaling pathway
GO:0055092 IMP:FlyBase P sterol homeostasis
GO:0015918 IMP:FlyBase P sterol transport
GO:0008039 IMP:FlyBase P synaptic target recognition

KEGG Pathway Links

KEGG Pathway ID Description
dme04142 Lysosome
ko04142 Lysosome

Domain Information

InterPro Annotations

Accession Description
IPR014756 Immunoglobulin E-set
IPR003172 MD-2-related lipid-recognition domain

UniProt Annotations

Entry Information

Gene Name
Niemann-Pick type C-2a
Protein Entry
NPC2_DROME
UniProt ID
Q9VQ62
Species
Drosophila

Comments

Comment Type Description
Developmental Stage Expressed both maternally and zygotically. {ECO:0000269|PubMed:17804599}.
Disruption Phenotype Abnormal sterol distribution in many cells, also lower than normal ecdysteroid levels. Npc2a and Npc2b double mutants undergo apoptotic neurodegeneration. {ECO:0000269|PubMed:17804599}.
Function Functions redundantly with Npc2b in regulating sterol homeostasis and ecdysteroid biosynthesis, probably by controlling the availability of sterol substrate. {ECO:0000269|PubMed:17804599}.
Interaction Q9VPU1:dock; NbExp=1; IntAct=EBI-183186, EBI-189398;
Similarity Belongs to the NPC2 family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000305}.
Tissue Specificity Broadly expressed with a higher level of expression in many tissues, including midgut, salivary gland and ventral nerve cord. {ECO:0000269|PubMed:17804599}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009132 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20129163 RefSeq NP_608637 148 Niemann-Pick type C-2a

Identical Sequences to LMP009132 proteins

Reference Database Accession Length Protein Name
GI:20129163 GenBank AAM50670.1 148 GH22047p [Drosophila melanogaster]
GI:20129163 GenBank AAN71605.1 148 RH53228p [Drosophila melanogaster]
GI:20129163 GenBank ACL87521.1 148 NPC2-PA, partial [synthetic construct]
GI:20129163 GenBank ACL92066.1 148 NPC2-PA [synthetic construct]
GI:20129163 gnl FlyBase 148 Niemann-Pick type C-2a [Drosophila melanogaster]
GI:20129163 SwissProt Q9VQ62.1 148 RecName: Full=Protein NPC2 homolog; AltName: Full=Niemann Pick type C2 protein homolog; Flags: Precursor [Drosophila melanogaster]

Related Sequences to LMP009132 proteins

Reference Database Accession Length Protein Name
GI:20129163 GenBank EDV57399.1 148 GG24820 [Drosophila erecta]
GI:20129163 GenBank EDW87311.1 148 GE17856 [Drosophila yakuba]
GI:20129163 GenBank EDX03391.1 148 GD23124 [Drosophila simulans]
GI:20129163 RefSeq XP_001968340.1 148 GG24820 [Drosophila erecta]
GI:20129163 RefSeq XP_002087599.1 148 GE17856 [Drosophila yakuba]
GI:20129163 RefSeq XP_002077806.1 148 GD23124 [Drosophila simulans]