Gene/Proteome Database (LMPD)

LMPD ID
LMP009137
Gene ID
2768718
Species
Drosophila melanogaster (Drosophila)
Gene Name
quiver
Gene Symbol
qvr
Synonyms
anon-WO02059370.1; BcDNA:GH06755; CG30032; CG33472; Dmel\CG33472; sss
Chromosome
2R
Map Location
47F13-47F13

Proteins

quiver, isoform B
Refseq ID NP_001137646
Protein GI 221330178
UniProt ID B5A5T4
mRNA ID NM_001144174
Length 158
RefSeq Status REVIEWED
MWTQRNAVGNWLLVLTAVIGFLTFIWIPQTSAECQTRSIYCYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCCVKMVRHQRSPYEVVRRMCTSQLQINLFMVDHVCMMESSGNGHMCFCEEDMCNSSKNLHTNGCQLHLIPIAVAVSWLMGQLLSR
quiver, isoform C
Refseq ID NP_001286318
Protein GI 665400242
mRNA ID NM_001299389
Length 155
RefSeq Status REVIEWED
MWTQRNAVGNWLLVLTVFLALAKFATTDNCFPTRSIYCYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCCVKMVRHQRSPYEVVRRMCTSQLQINLFMVDHVCMMESSGNGHMCFCEEDMCNSSKNLHTNGCQLHLIPIAVAVSWLMGQLLSR

Gene Information

Entrez Gene ID
2768718
Gene Name
quiver
Gene Symbol
qvr
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 IEA:UniProtKB-KW C anchored component of membrane
GO:0009897 IDA:FlyBase C external side of plasma membrane
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0034235 IDA:UniProtKB F GPI anchor binding
GO:0045837 IGI:FlyBase P negative regulation of membrane potential
GO:0045938 IMP:FlyBase P positive regulation of circadian sleep/wake cycle, sleep
GO:0045187 IMP:UniProtKB P regulation of circadian sleep/wake cycle, sleep
GO:0032222 IMP:FlyBase P regulation of synaptic transmission, cholinergic
GO:0030431 IGI:FlyBase P sleep

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
quiver
Protein Entry
QVR_DROME
Species
Drosophila

Comments

Comment Type Description
Disruption Phenotype Both daytime and nighttime sleep are severely reduced in both males and females. A small percentage of flies (around 9%) do not sleep at all. A moderate reduction has minimal effects on baseline sleep but markedly reduces the amount of recovery sleep after sleep deprivation. Mutants have impaired Sh-dependent K(+) current. {ECO:0000269|PubMed:18635795}.
Function Required for homeostatic regulation of sleep under normal conditions and after sleep deprivation. Important regulator of the Sh K(+) channel, acting as a signaling molecule that connects sleep drive to lowered membrane excitability, possibly by enhancing K(+) channel activity and thus reducing neuronal excitability. {ECO:0000269|PubMed:18635795}.
Ptm N-glycosylated. {ECO:0000269|PubMed:18635795}.
Sequence Caution Sequence=AAL90233.1; Type=Miscellaneous discrepancy; Note=Several sequencing errors.; Evidence={ECO:0000305};
Similarity Belongs to the quiver family. {ECO:0000305}.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity Enriched in brain and head. {ECO:0000269|PubMed:18635795}.
Web Resource Name=Protein Spotlight; Note=Sleepless nights - Issue 101 of January 2009; URL="http://web.expasy.org/spotlight/back_issues/101";

Identical and Related Proteins

Unique RefSeq proteins for LMP009137 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
221330178 RefSeq NP_001137646 158 quiver, isoform B
665400242 RefSeq NP_001286318 155 quiver, isoform C

Identical Sequences to LMP009137 proteins

Reference Database Accession Length Protein Name
GI:221330178 GenBank EDV56458.1 158 GG20204 [Drosophila erecta]
GI:221330178 gnl FlyBase 158 quiver, isoform B [Drosophila melanogaster]
GI:665400242 gnl FlyBase 155 quiver, isoform C [Drosophila melanogaster]
GI:221330178 RefSeq XP_001976058.1 158 GG20204 [Drosophila erecta]
GI:221330178 SwissProt B3NSF6.1 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila erecta]
GI:221330178 SwissProt B5A5T4.2 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila melanogaster]

Related Sequences to LMP009137 proteins

Reference Database Accession Length Protein Name
GI:665400242 GenBank EDV56458.1 158 GG20204 [Drosophila erecta]
GI:221330178 GenBank EDW90916.1 158 GE12364 [Drosophila yakuba]
GI:221330178 GenBank ACF58241.1 158 sleepless [Drosophila melanogaster]
GI:665400242 gnl FlyBase 158 quiver, isoform B [Drosophila melanogaster]
GI:665400242 RefSeq XP_001976058.1 158 GG20204 [Drosophila erecta]
GI:221330178 RefSeq XP_002091204.1 158 GE12364 [Drosophila yakuba]
GI:665400242 RefSeq NP_001137646.1 158 quiver, isoform B [Drosophila melanogaster]
GI:665400242 SwissProt B3NSF6.1 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila erecta]
GI:221330178 SwissProt B4P641.1 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila yakuba]
GI:221330178 SwissProt B4HNI3.2 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila sechellia]
GI:221330178 SwissProt B4QBL6.2 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila simulans]
GI:665400242 SwissProt B5A5T4.2 158 RecName: Full=Protein quiver; AltName: Full=Protein sleepless; Flags: Precursor [Drosophila melanogaster]