Gene/Proteome Database (LMPD)

LMPD ID
LMP009173
Gene ID
42514
Species
Drosophila melanogaster (Drosophila)
Gene Name
Sensory neuron membrane protein 1
Gene Symbol
Snmp1
Synonyms
CG7000; Dmel\CG7000; snmp; Snmp; SNMP; snmp1; SNMP1
Chromosome
3R
Map Location
93C2-93C2

Proteins

sensory neuron membrane protein 1, isoform A
Refseq ID NP_650953
Protein GI 24648653
UniProt ID Q9VDD3
mRNA ID NM_142696
Length 551
RefSeq Status REVIEWED
Protein sequence is identical to GI:442620282 (mRNA isoform)
sensory neuron membrane protein 1, isoform B
Refseq ID NP_001262803
Protein GI 442620282
UniProt ID Q9VDD3
mRNA ID NM_001275874
Length 551
RefSeq Status REVIEWED
MQVPRVKLLMGSGAMFVFAIIYGWVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVFNVTNPDEVSEGAKPRLQEVGPFVFDEWKDKYDLEDDVVEDTVSFTMRNTFIFNPKESLPLTGEEEIILPHPIMLPGGISVQREKAAMMELVSKGLSIVFPDAKAFLKAKFMDLFFRGINVDCSSEEFSAKALCTVFYTGEIKQAKQVNQTHFLFSFMGQANHSDSGRFTVCRGVKNNKKLGKVVKFADEPEQDIWPDGECNTFVGTDSTVFAPGLKKEDGLWAFTPDLCRSLGAYYQHKSSYHGMPSMRYTLDLGDIRADEKLHCFCEDPEDLDTCPPKGTMNLAACVGGPLMASMPHFYLGDPKLVADVDGLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEPMKNLPKLILPMFWVEEGVQLNKTYTNLVKYTLFLGLKINSVLRWSLITFSLVGLMFSAYLFYHKSDSLDINSILKDNNKVDDVASTKEPLPSANPKQSSTVHPVQLPNTLIPGTNPATNPATHHKMEHRERY

Gene Information

Entrez Gene ID
42514
Gene Name
Sensory neuron membrane protein 1
Gene Symbol
Snmp1
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030425 IDA:FlyBase C dendrite
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043025 IDA:FlyBase C neuronal cell body
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0007155 IEA:InterPro P cell adhesion
GO:0007166 IMP:FlyBase P cell surface receptor signaling pathway
GO:0055088 IMP:FlyBase P lipid homeostasis
GO:0035073 IMP:FlyBase P pupariation
GO:0019236 IMP:FlyBase P response to pheromone
GO:0007608 IEA:UniProtKB-KW P sensory perception of smell

Domain Information

InterPro Annotations

Accession Description
IPR005428 Adhesion molecule CD36
IPR002159 CD36 antigen

UniProt Annotations

Entry Information

Gene Name
Sensory neuron membrane protein 1
Protein Entry
Q9VDD3_DROME
UniProt ID
Q9VDD3
Species
Drosophila

Comments

Comment Type Description
Disruption Phenotype Mutants are viable and fertile with no gross morphological or locomotor defects.
Function Plays an olfactory role that is not restricted to pheromone sensitivity. Has a role in detection and signal transduction of the fatty-acid-derived male pheromone 11-cis vaccenyl acetate (cVA). Not required for sensitivity to general odorants. Acts in concert with Or67d and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Essential for the electrophysiological responses of these olfactory sensory neurons (OSNs) to cVA. Not required for the development of trichoid OSNs and support cells.
Similarity Belongs to the CD36 family.
Subcellular Location Cell membrane ; Multi-pass membrane protein .
Tissue Specificity Selectively expressed in antenna. Expressed in lateral-distal population of OSNs that coexpress Orco, in non- neuronal support cells that surround these OSNs, in support cells elsewhere in the antenna and chemosensory organs on the proboscis. Expressed in trichoid sensory cilia (at protein level).

Identical and Related Proteins

Unique RefSeq proteins for LMP009173 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
442620282 RefSeq NP_001262803 551 sensory neuron membrane protein 1, isoform B

Identical Sequences to LMP009173 proteins

Reference Database Accession Length Protein Name
GI:442620282 GenBank ABC86348.1 551 IP13851p [Drosophila melanogaster]
GI:442620282 gnl FlyBase 551 sensory neuron membrane protein 1, isoform A [Drosophila melanogaster]
GI:442620282 gnl FlyBase 551 sensory neuron membrane protein 1, isoform B [Drosophila melanogaster]
GI:442620282 RefSeq NP_650953.1 551 sensory neuron membrane protein 1, isoform A [Drosophila melanogaster]
GI:442620282 SwissProt Q9VDD3.2 551 RecName: Full=Sensory neuron membrane protein 1; Short=SNMP1Dmel [Drosophila melanogaster]

Related Sequences to LMP009173 proteins

Reference Database Accession Length Protein Name
GI:442620282 GenBank EDW51598.1 551 GM15095 [Drosophila sechellia]
GI:442620282 GenBank EDX12123.1 551 GD20002 [Drosophila simulans]
GI:442620282 RefSeq XP_002044254.1 551 GM15095 [Drosophila sechellia]
GI:442620282 RefSeq XP_002102620.1 551 GD20002 [Drosophila simulans]
GI:442620282 SwissProt B4IKJ4.1 551 RecName: Full=Sensory neuron membrane protein 1 [Drosophila sechellia]
GI:442620282 SwissProt B4R136.1 551 RecName: Full=Sensory neuron membrane protein 1 [Drosophila simulans]