Gene/Proteome Database (LMPD)
Proteins
| sensory neuron membrane protein 1, isoform A | |
|---|---|
| Refseq ID | NP_650953 |
| Protein GI | 24648653 |
| UniProt ID | Q9VDD3 |
| mRNA ID | NM_142696 |
| Length | 551 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:442620282 (mRNA isoform) | |
| sensory neuron membrane protein 1, isoform B | |
|---|---|
| Refseq ID | NP_001262803 |
| Protein GI | 442620282 |
| UniProt ID | Q9VDD3 |
| mRNA ID | NM_001275874 |
| Length | 551 |
| RefSeq Status | REVIEWED |
| MQVPRVKLLMGSGAMFVFAIIYGWVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVFNVTNPDEVSEGAKPRLQEVGPFVFDEWKDKYDLEDDVVEDTVSFTMRNTFIFNPKESLPLTGEEEIILPHPIMLPGGISVQREKAAMMELVSKGLSIVFPDAKAFLKAKFMDLFFRGINVDCSSEEFSAKALCTVFYTGEIKQAKQVNQTHFLFSFMGQANHSDSGRFTVCRGVKNNKKLGKVVKFADEPEQDIWPDGECNTFVGTDSTVFAPGLKKEDGLWAFTPDLCRSLGAYYQHKSSYHGMPSMRYTLDLGDIRADEKLHCFCEDPEDLDTCPPKGTMNLAACVGGPLMASMPHFYLGDPKLVADVDGLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEPMKNLPKLILPMFWVEEGVQLNKTYTNLVKYTLFLGLKINSVLRWSLITFSLVGLMFSAYLFYHKSDSLDINSILKDNNKVDDVASTKEPLPSANPKQSSTVHPVQLPNTLIPGTNPATNPATHHKMEHRERY | |
Gene Information
Entrez Gene ID
Gene Name
Sensory neuron membrane protein 1
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030425 | IDA:FlyBase | C | dendrite |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043025 | IDA:FlyBase | C | neuronal cell body |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0007155 | IEA:InterPro | P | cell adhesion |
| GO:0007166 | IMP:FlyBase | P | cell surface receptor signaling pathway |
| GO:0055088 | IMP:FlyBase | P | lipid homeostasis |
| GO:0035073 | IMP:FlyBase | P | pupariation |
| GO:0019236 | IMP:FlyBase | P | response to pheromone |
| GO:0007608 | IEA:UniProtKB-KW | P | sensory perception of smell |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Sensory neuron membrane protein 1
Protein Entry
Q9VDD3_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | Mutants are viable and fertile with no gross morphological or locomotor defects. |
| Function | Plays an olfactory role that is not restricted to pheromone sensitivity. Has a role in detection and signal transduction of the fatty-acid-derived male pheromone 11-cis vaccenyl acetate (cVA). Not required for sensitivity to general odorants. Acts in concert with Or67d and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Essential for the electrophysiological responses of these olfactory sensory neurons (OSNs) to cVA. Not required for the development of trichoid OSNs and support cells. |
| Similarity | Belongs to the CD36 family. |
| Subcellular Location | Cell membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Selectively expressed in antenna. Expressed in lateral-distal population of OSNs that coexpress Orco, in non- neuronal support cells that surround these OSNs, in support cells elsewhere in the antenna and chemosensory organs on the proboscis. Expressed in trichoid sensory cilia (at protein level). |
Identical and Related Proteins
Unique RefSeq proteins for LMP009173 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 442620282 | RefSeq | NP_001262803 | 551 | sensory neuron membrane protein 1, isoform B |
Identical Sequences to LMP009173 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442620282 | GenBank | ABC86348.1 | 551 | IP13851p [Drosophila melanogaster] |
| GI:442620282 | gnl | FlyBase | 551 | sensory neuron membrane protein 1, isoform A [Drosophila melanogaster] |
| GI:442620282 | gnl | FlyBase | 551 | sensory neuron membrane protein 1, isoform B [Drosophila melanogaster] |
| GI:442620282 | RefSeq | NP_650953.1 | 551 | sensory neuron membrane protein 1, isoform A [Drosophila melanogaster] |
| GI:442620282 | SwissProt | Q9VDD3.2 | 551 | RecName: Full=Sensory neuron membrane protein 1; Short=SNMP1Dmel [Drosophila melanogaster] |
Related Sequences to LMP009173 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442620282 | GenBank | EDW51598.1 | 551 | GM15095 [Drosophila sechellia] |
| GI:442620282 | GenBank | EDX12123.1 | 551 | GD20002 [Drosophila simulans] |
| GI:442620282 | RefSeq | XP_002044254.1 | 551 | GM15095 [Drosophila sechellia] |
| GI:442620282 | RefSeq | XP_002102620.1 | 551 | GD20002 [Drosophila simulans] |
| GI:442620282 | SwissProt | B4IKJ4.1 | 551 | RecName: Full=Sensory neuron membrane protein 1 [Drosophila sechellia] |
| GI:442620282 | SwissProt | B4R136.1 | 551 | RecName: Full=Sensory neuron membrane protein 1 [Drosophila simulans] |