Gene/Proteome Database (LMPD)

LMPD ID
LMP009640
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
hydroxysteroid dehydrogenase 3
Gene Symbol
Synonyms
ATHSD3; HSD3; hydroxysteroid dehydrogenase 3; HYDROXYSTEROID DEHYDROGENASE 3
Alternate Names
hydroxysteroid dehydrogenase 3
Chromosome
3
EC Number
1.1.1.-
Summary
Encodes a putative hydroxysteroid dehydrogenase (HSD). Genes that encode HSD include: At5g50600 and At5g50700 (HSD1), At3g47350(HSD2), At3g47360(HSD3), At5g50590 and At5g50690(HSD4), At5g50770(HSD6) (Plant Cell Physiology 50:1463). Two copies of HSD1 and HSD4 exist due to a gene duplication event. In Plant Physiology 145:87, At5g50690 is HSD7, At4g10020 is HSD5.
Orthologs

Proteins

hydroxysteroid dehydrogenase 3
Refseq ID NP_190320
Protein GI 15232779
UniProt ID Q9STY7
mRNA ID NM_114604
Length 309
RefSeq Status REVIEWED
MDILTTILNLLLPPLTIIFLFLFYPFYLLIKLVLCLRKNLHFENVARKVVLITGASSGIGEHVAYEYAKKGAYLALVARRRDRLEIVAETSRQLGSGNVIIIPGDVSNVEDCKKFIDETIRHFGKLDHLINNAGVFQTVLFEDFTQIQDANPIMDINFWGTTYITYFAIPHLRKSKGKIVAITSGSANIPLPLASIYAASKAALLRFFETLRIELSPDIKITIVLPGVVSTDMTTPHCIEKYGSDFILSESVSKCAKAIFRGIGRGETYIEEPSWMKWLFIMKNVCPEIVDYGLNYLFVSYLKPYFKRD

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid dehydrogenase 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016491 IEA:UniProtKB-KW F oxidoreductase activity
GO:0006694 IEA:UniProtKB-KW P steroid biosynthetic process

REACTOME Pathway Links

REACTOME Pathway ID Description
6254052 Glucocorticoid biosynthesis
6253653 Metabolism
6253725 Metabolism of lipids and lipoproteins
6254047 Metabolism of steroid hormones and vitamin D

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid dehydrogenase 3
Protein Entry
HSD3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009640 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15232779 RefSeq NP_190320 309 hydroxysteroid dehydrogenase 3

Identical Sequences to LMP009640 proteins

Reference Database Accession Length Protein Name
GI:15232779 EMBL CAB51208.1 309 putative protein [Arabidopsis thaliana]
GI:15232779 GenBank AEE78270.1 309 hydroxysteroid dehydrogenase 3 [Arabidopsis thaliana]
GI:15232779 SwissProt Q9STY7.1 309 RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 3; AltName: Full=17-beta-hydroxysteroid dehydrogenase-like 3; AltName: Full=Hydroxysteroid dehydrogenase 3; Short=AtHSD3 [Arabidopsis thaliana]

Related Sequences to LMP009640 proteins

Reference Database Accession Length Protein Name
GI:15232779 GenBank EFH52092.1 309 short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15232779 GenBank KFK34034.1 528 hypothetical protein AALP_AA5G093400 [Arabis alpina]
GI:15232779 RefSeq XP_002875833.1 309 short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15232779 RefSeq XP_010503336.1 309 PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina sativa]
GI:15232779 RefSeq XP_010515042.1 309 PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina sativa]
GI:15232779 RefSeq XP_010426176.1 309 PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina sativa]