Gene/Proteome Database (LMPD)

LMPD ID
LMP009720
Gene ID
842561
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketoacyl-acyl carrier protein synthase III
Gene Symbol
KAS III
Synonyms
3-ketoacyl-acyl carrier protein synthase III; 3-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE III; KAS III; T3P18.20; T3P18_20
Alternate Names
3-ketoacyl-acyl carrier protein synthase III
Chromosome
1
EC Number
2.3.1.180
Summary
3-ketoacyl-acyl carrier protein synthase III (KAS III)
Orthologs
View orthologs and multiple alignments for KAS III

Proteins

3-ketoacyl-acyl carrier protein synthase III
Refseq ID NP_001031221
Protein GI 79320515
UniProt ID P49243
mRNA ID NM_001036144
Length 404
RefSeq Status REVIEWED
MANASGFFTHPSIPNLRSRIHVPVRVSGSGFCVSNRFSKRVLCSSVSSVDKDASSSPSQYQRPRLVPSGCKLIGCGSAVPSLLISNDDLAKIVDTNDEWIATRTGIRNRRVVSGKDSLVGLAVEAATKALEMAEVVPEDIDLVLMCTSTPDDLFGAAPQIQKALGCTKNPLAYDITAACSGFVLGLVSAACHIRGGGFKNVLVIGADSLSRFVDWTDRGTCILFGDAAGAVVVQACDIEDDGLFSFDVHSDGDGRRHLNASVKESQNDGESSSNGSVFGDFPPKQSSYSCIQMNGKEVFRFAVKCVPQSIESALQKAGLPASAIDWLLLHQANQRIIDSVATRLHFPPERVISNLANYGNTSAASIPLALDEAVRSGKVKPGHTIATSGFGAGLTWGSAIMRWR
3-ketoacyl-acyl carrier protein synthase III
Refseq ID NP_176452
Protein GI 15221522
UniProt ID P49243
mRNA ID NM_104942
Length 404
RefSeq Status REVIEWED
Protein sequence is identical to GI:79320515 (mRNA isoform)

Gene Information

Entrez Gene ID
842561
Gene Name
3-ketoacyl-acyl carrier protein synthase III
Gene Symbol
KAS III
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0009570 IDA:TAIR C chloroplast stroma
GO:0004315 IEA:InterPro F 3-oxoacyl-[acyl-carrier-protein] synthase activity
GO:0033818 IEA:UniProtKB-EC F beta-ketoacyl-acyl-carrier-protein synthase III activity
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00061 Fatty acid biosynthesis
ath_M00083 Fatty acid biosynthesis, elongation
ath_M00082 Fatty acid biosynthesis, initiation
ath01212 Fatty acid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal
IPR004655 3-oxoacyl-[acyl-carrier-protein] synthase 3
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
3-ketoacyl-acyl carrier protein synthase III
Protein Entry
FABH_ARATH
UniProt ID
P49243
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Acetyl-CoA + malonyl-[acyl-carrier-protein] = acetoacetyl-[acyl-carrier-protein] + CoA + CO(2).
Function Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. KAS III catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities (By similarity). {ECO:0000250}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Sequence Caution Sequence=AAD43621.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAF19534.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the FabH family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast.

Identical and Related Proteins

Unique RefSeq proteins for LMP009720 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
79320515 RefSeq NP_001031221 404 3-ketoacyl-acyl carrier protein synthase III

Identical Sequences to LMP009720 proteins

Reference Database Accession Length Protein Name
GI:79320515 GenBank AAL36160.1 404 putative 3-ketoacyl-acyl carrier protein synthase III (KAS III) [Arabidopsis thaliana]
GI:79320515 GenBank AAM14214.1 404 putative 3-ketoacyl-acyl carrier protein synthase III (KAS III) [Arabidopsis thaliana]
GI:79320515 GenBank AEE33989.1 404 3-ketoacyl-acyl carrier protein synthase III [Arabidopsis thaliana]
GI:79320515 GenBank AEE33990.1 404 3-ketoacyl-acyl carrier protein synthase III [Arabidopsis thaliana]
GI:79320515 RefSeq NP_176452.1 404 3-ketoacyl-acyl carrier protein synthase III [Arabidopsis thaliana]
GI:79320515 SwissProt P49243.2 404 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic; AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS III; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009720 proteins

Reference Database Accession Length Protein Name
GI:79320515 DBBJ BAH20176.1 404 AT1G62640 [Arabidopsis thaliana]
GI:79320515 GenBank AAA61348.1 404 3-ketoacyl-acyl carrier protein synthase III (KAS III) [Arabidopsis thaliana]
GI:79320515 GenBank AAD43621.1 435 T3P18.20 [Arabidopsis thaliana]
GI:79320515 GenBank AAF19534.1 495 F23N19.2 [Arabidopsis thaliana]
GI:79320515 GenBank EFH64271.1 404 kas III [Arabidopsis lyrata subsp. lyrata]
GI:79320515 RefSeq XP_002888012.1 404 kas III [Arabidopsis lyrata subsp. lyrata]