Gene/Proteome Database (LMPD)

LMPD ID
LMP009728
Gene ID
825864
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
4-coumarate--CoA ligase-like 7
Gene Symbol
AT4G05160
Synonyms
C17L7.80; C17L7_80
Alternate Names
4-coumarate--CoA ligase-like 7
Chromosome
4
EC Number
6.2.1.-
Summary
Encodes a peroxisomal protein involved in the activation of fatty acids through esterification with CoA. At4g05160 preferentially activates fatty acids with medium chain length (C6:0 and C7:0) as well as even-numbered long-chain fatty acids (C14:0, C16:0 and C18:0). At4g05160 was also able to catalyze the conversion of OPC-6:0 to its CoA ester and is therefore thought to be involved in the peroxisomal β-oxidation steps of jasmonic acid biosynthesis.
Orthologs
View orthologs and multiple alignments for AT4G05160

Proteins

4-coumarate--CoA ligase-like 7
Refseq ID NP_192425
Protein GI 15234634
UniProt ID Q9M0X9
mRNA ID NM_116755
Length 544
RefSeq Status REVIEWED
MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQLKSAVARLAHGFHRLGIRKNDVVLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKIIISVNQLFDKIKGFDLPVVLLGSKDTVEIPPGSNSKILSFDNVMELSEPVSEYPFVEIKQSDTAALLYSSGTTGTSKGVELTHGNFIAASLMVTMDQDLMGEYHGVFLCFLPMFHVFGLAVITYSQLQRGNALVSMARFELELVLKNIEKFRVTHLWVVPPVFLALSKQSIVKKFDLSSLKYIGSGAAPLGKDLMEECGRNIPNVLLMQGYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKSQPPNQQGEIWVRGPNMMKGYLNNPQATKETIDKKSWVHTGDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEGLLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKFIAKQVAPYKRLRRVSFISLVPKSAAGKILRRELVQQVRSKM

Gene Information

Entrez Gene ID
825864
Gene Name
4-coumarate--CoA ligase-like 7
Gene Symbol
AT4G05160
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005777 IDA:TAIR C peroxisome
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004321 IDA:TAIR F fatty-acyl-CoA synthase activity
GO:0016874 IEA:UniProtKB-KW F ligase activity
GO:0009695 IDA:TAIR P jasmonic acid biosynthetic process
GO:0031408 IEA:UniProtKB-KW P oxylipin biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath_M00350 Capsaicin biosynthesis, L-Phenylalanine => Capsaicin
ath_M00137 Flavanone biosynthesis, phenylalanine => naringenin
ath00940 Phenylpropanoid biosynthesis
ath00130 Ubiquinone and other terpenoid-quinone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR025110 AMP-binding enzyme C-terminal domain
IPR020845 AMP-binding, conserved site
IPR000873 AMP-dependent synthetase/ligase

UniProt Annotations

Entry Information

Gene Name
4-coumarate--CoA ligase-like 7
Protein Entry
4CLL7_ARATH
UniProt ID
Q9M0X9
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=9 uM for nonanoic acid;
Domain Both substrate-binding domains (SBD1 and SBD2) are involved in the substrate recognition, and are sufficient to confer the substrate specificity. {ECO:0000250}.
Function Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors. {ECO:0000269|PubMed:15677481}.
Induction By methyl jasmonate. {ECO:0000269|PubMed:15677481}.
Similarity Belongs to the ATP-dependent AMP-binding enzyme family. {ECO:0000305}.
Subcellular Location Peroxisome {ECO:0000269|PubMed:15677481}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009728 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15234634 RefSeq NP_192425 544 4-coumarate--CoA ligase-like 7

Identical Sequences to LMP009728 proteins

Reference Database Accession Length Protein Name
GI:15234634 EMBL CBU97196.1 544 unnamed protein product [Arabidopsis thaliana]
GI:15234634 EMBL CBU89818.1 544 unnamed protein product [Arabidopsis thaliana]
GI:15234634 GenBank AEE82486.1 544 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
GI:15234634 GenBank AGF14617.1 544 Sequence 14036 from patent US 8362325
GI:15234634 GenBank AGX56847.1 544 Sequence 14013 from patent US 8541208
GI:15234634 GenBank AGX64692.1 544 Sequence 29450 from patent US 8541208

Related Sequences to LMP009728 proteins

Reference Database Accession Length Protein Name
GI:15234634 GenBank EFH48997.1 544 hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. lyrata]
GI:15234634 GenBank EOA20338.1 544 hypothetical protein CARUB_v10000646mg [Capsella rubella]
GI:15234634 RefSeq XP_002872738.1 544 hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. lyrata]
GI:15234634 RefSeq XP_006287440.1 544 hypothetical protein CARUB_v10000646mg [Capsella rubella]
GI:15234634 RefSeq XP_010422413.1 543 PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
GI:15234634 RefSeq XP_010455853.1 543 PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]