Gene/Proteome Database (LMPD)
LMPD ID
LMP009760
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 4
Gene Symbol
Synonyms
acyl carrier protein 4; F24A6.4
Chromosome
4
Summary
encodes an acyl carrier protein predominantly expressed in leaves. Gene expression is upregulated by light.
Orthologs
Proteins
| acyl carrier protein 4 | |
|---|---|
| Refseq ID | NP_001190831 |
| Protein GI | 334186904 |
| UniProt ID | F4JRT7 |
| mRNA ID | NM_001203902 |
| Length | 149 |
| RefSeq Status | REVIEWED |
| MASLSTTSLSFKAPSTTISQVLRKASSSQSVTFGRFTSSTKSLRLQISCAAKAETVQKVSDIVKEQLALAADVPLTAESKFSALGADSLDTVCYTLSVSYHCHVEIVMALEEKFNISVEESDAQNITTIQEAADLIEDLVQKKPAAETS | |
Gene Information
Entrez Gene ID
Gene Name
acyl carrier protein 4
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
| Similarity | Contains 1 acyl carrier domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009760 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 334186904 | RefSeq | NP_001190831 | 149 | acyl carrier protein 4 |
| 15234875 | RefSeq | NP_194235 | 137 | acyl carrier protein 4 |
Identical Sequences to LMP009760 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15234875 | EMBL | CAB79414.1 | 137 | acyl carrier-like protein [Arabidopsis thaliana] |
| GI:15234875 | GenBank | AAK62583.1 | 137 | AT4g25050/F13M23_190 [Arabidopsis thaliana] |
| GI:15234875 | GenBank | AAK91484.1 | 137 | AT4g25050/F13M23_190 [Arabidopsis thaliana] |
| GI:15234875 | GenBank | AAM61278.1 | 137 | acyl carrier-like protein [Arabidopsis thaliana] |
| GI:15234875 | GenBank | AEE84996.1 | 137 | acyl carrier protein 4 [Arabidopsis thaliana] |
| GI:334186904 | GenBank | AEE84997.1 | 149 | acyl carrier protein 4 [Arabidopsis thaliana] |
| GI:15234875 | SwissProt | Q9SW21.1 | 137 | RecName: Full=Acyl carrier protein 4, chloroplastic; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP009760 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:334186904 | EMBL | CAB36747.1 | 137 | acyl carrier-like protein [Arabidopsis thaliana] |
| GI:334186904 | GenBank | AAK62583.1 | 137 | AT4g25050/F13M23_190 [Arabidopsis thaliana] |
| GI:334186904 | GenBank | AAK91484.1 | 137 | AT4g25050/F13M23_190 [Arabidopsis thaliana] |
| GI:334186904 | GenBank | AAM61278.1 | 137 | acyl carrier-like protein [Arabidopsis thaliana] |
| GI:15234875 | GenBank | EFH45950.1 | 136 | hypothetical protein ARALYDRAFT_914076 [Arabidopsis lyrata subsp. lyrata] |
| GI:15234875 | GenBank | AEE84997.1 | 149 | acyl carrier protein 4 [Arabidopsis thaliana] |
| GI:334186904 | RefSeq | NP_194235.1 | 137 | acyl carrier protein 4 [Arabidopsis thaliana] |
| GI:15234875 | RefSeq | XP_002869691.1 | 136 | hypothetical protein ARALYDRAFT_914076 [Arabidopsis lyrata subsp. lyrata] |
| GI:15234875 | RefSeq | NP_001190831.1 | 149 | acyl carrier protein 4 [Arabidopsis thaliana] |
| GI:15234875 | RefSeq | XP_010433694.1 | 135 | PREDICTED: acyl carrier protein 4, chloroplastic-like [Camelina sativa] |
| GI:15234875 | RefSeq | XP_010438929.1 | 135 | PREDICTED: acyl carrier protein 4, chloroplastic [Camelina sativa] |
| GI:334186904 | SwissProt | Q9SW21.1 | 137 | RecName: Full=Acyl carrier protein 4, chloroplastic; Flags: Precursor [Arabidopsis thaliana] |