Gene/Proteome Database (LMPD)

LMPD ID
LMP009760
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 4
Gene Symbol
Synonyms
acyl carrier protein 4; F24A6.4
Chromosome
4
Summary
encodes an acyl carrier protein predominantly expressed in leaves. Gene expression is upregulated by light.
Orthologs

Proteins

acyl carrier protein 4
Refseq ID NP_001190831
Protein GI 334186904
UniProt ID F4JRT7
mRNA ID NM_001203902
Length 149
RefSeq Status REVIEWED
MASLSTTSLSFKAPSTTISQVLRKASSSQSVTFGRFTSSTKSLRLQISCAAKAETVQKVSDIVKEQLALAADVPLTAESKFSALGADSLDTVCYTLSVSYHCHVEIVMALEEKFNISVEESDAQNITTIQEAADLIEDLVQKKPAAETS
acyl carrier protein 4
Refseq ID NP_194235
Protein GI 15234875
UniProt ID Q9SW21
mRNA ID NM_118637
Length 137
RefSeq Status REVIEWED
MASLSTTSLSFKAPSTTISQVLRKASSSQSVTFGRFTSSTKSLRLQISCAAKAETVQKVSDIVKEQLALAADVPLTAESKFSALGADSLDTVEIVMALEEKFNISVEESDAQNITTIQEAADLIEDLVQKKPAAETS

Gene Information

Entrez Gene ID
Gene Name
acyl carrier protein 4
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like

UniProt Annotations

Entry Information

Gene Name
acyl carrier protein 4
Protein Entry
ACP4_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Similarity Contains 1 acyl carrier domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP009760 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
334186904 RefSeq NP_001190831 149 acyl carrier protein 4
15234875 RefSeq NP_194235 137 acyl carrier protein 4

Identical Sequences to LMP009760 proteins

Reference Database Accession Length Protein Name
GI:15234875 EMBL CAB79414.1 137 acyl carrier-like protein [Arabidopsis thaliana]
GI:15234875 GenBank AAK62583.1 137 AT4g25050/F13M23_190 [Arabidopsis thaliana]
GI:15234875 GenBank AAK91484.1 137 AT4g25050/F13M23_190 [Arabidopsis thaliana]
GI:15234875 GenBank AAM61278.1 137 acyl carrier-like protein [Arabidopsis thaliana]
GI:15234875 GenBank AEE84996.1 137 acyl carrier protein 4 [Arabidopsis thaliana]
GI:334186904 GenBank AEE84997.1 149 acyl carrier protein 4 [Arabidopsis thaliana]
GI:15234875 SwissProt Q9SW21.1 137 RecName: Full=Acyl carrier protein 4, chloroplastic; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009760 proteins

Reference Database Accession Length Protein Name
GI:334186904 EMBL CAB36747.1 137 acyl carrier-like protein [Arabidopsis thaliana]
GI:334186904 GenBank AAK62583.1 137 AT4g25050/F13M23_190 [Arabidopsis thaliana]
GI:334186904 GenBank AAK91484.1 137 AT4g25050/F13M23_190 [Arabidopsis thaliana]
GI:334186904 GenBank AAM61278.1 137 acyl carrier-like protein [Arabidopsis thaliana]
GI:15234875 GenBank EFH45950.1 136 hypothetical protein ARALYDRAFT_914076 [Arabidopsis lyrata subsp. lyrata]
GI:15234875 GenBank AEE84997.1 149 acyl carrier protein 4 [Arabidopsis thaliana]
GI:334186904 RefSeq NP_194235.1 137 acyl carrier protein 4 [Arabidopsis thaliana]
GI:15234875 RefSeq XP_002869691.1 136 hypothetical protein ARALYDRAFT_914076 [Arabidopsis lyrata subsp. lyrata]
GI:15234875 RefSeq NP_001190831.1 149 acyl carrier protein 4 [Arabidopsis thaliana]
GI:15234875 RefSeq XP_010433694.1 135 PREDICTED: acyl carrier protein 4, chloroplastic-like [Camelina sativa]
GI:15234875 RefSeq XP_010438929.1 135 PREDICTED: acyl carrier protein 4, chloroplastic [Camelina sativa]
GI:334186904 SwissProt Q9SW21.1 137 RecName: Full=Acyl carrier protein 4, chloroplastic; Flags: Precursor [Arabidopsis thaliana]