Gene/Proteome Database (LMPD)

LMPD ID
LMP009761
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 1
Gene Symbol
Synonyms
F16B22.11; mitochondrial acyl carrier protein 1; MITOCHONDRIAL ACYL CARRIER PROTEIN 1; MTACP-1; MTACP1
Alternate Names
acyl carrier protein 1
Chromosome
2
Summary
Encodes a member of the mitochondrial acyl carrier protein (ACP) family. As part of the mitochondrial matrix, it is likely to be involved in fatty acid or lipoic acid biogenesis. Its acylated form is predominantly present in the mitochondrial membrane while the non-acylated form is soluble.
Orthologs

Proteins

acyl carrier protein 1
Refseq ID NP_181990
Protein GI 15224918
UniProt ID P53665
mRNA ID NM_130026
Length 122
RefSeq Status REVIEWED
MALRNAILRHLRVPVQTLGLNQSKIGFLGTIRSFSSHDDHLSREAVVDRVLDVVKSFPKVDPSKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKEADKIDSCSLAIEYVYNHPMSS

Gene Information

Entrez Gene ID
Gene Name
acyl carrier protein 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005759 IDA:TAIR C mitochondrial matrix
GO:0005739 IDA:TAIR C mitochondrion
GO:0070469 IEA:UniProtKB-KW C respiratory chain
GO:0006633 IDA:TAIR P fatty acid biosynthetic process
GO:0055114 IEA:UniProtKB-KW P oxidation-reduction process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00190 Oxidative phosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
acyl carrier protein 1
Protein Entry
ACPM1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity). {ECO:0000250}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Ptm 4'-phosphopantetheine is transferred from CoA to a specific serine of the apo-ACP-like protein. {ECO:0000305}.
Similarity Contains 1 acyl carrier domain. {ECO:0000305}.
Subcellular Location Mitochondrion.
Subunit Complex I is composed of at least 49 different subunits.

Identical and Related Proteins

Unique RefSeq proteins for LMP009761 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15224918 RefSeq NP_181990 122 acyl carrier protein 1

Identical Sequences to LMP009761 proteins

Reference Database Accession Length Protein Name
GI:15224918 GenBank AAB96840.1 122 acyl carrier protein precursor [Arabidopsis thaliana]
GI:15224918 GenBank AEC10448.1 122 acyl carrier protein 1 [Arabidopsis thaliana]
GI:15224918 gnl TIGR 122 acyl carrier protein [Arabidopsis thaliana]
GI:15224918 SwissProt P53665.1 122 RecName: Full=Acyl carrier protein 1, mitochondrial; AltName: Full=MtACP-1; Short=ACP; AltName: Full=NADH-ubiquinone oxidoreductase 9.6 kDa subunit; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009761 proteins

Reference Database Accession Length Protein Name
GI:15224918 GenBank AAK96481.1 122 At2g44620/F16B22.11 [Arabidopsis thaliana]
GI:15224918 GenBank AAL31242.1 122 At2g44620/F16B22.11 [Arabidopsis thaliana]
GI:15224918 GenBank EFH56385.1 122 mtACP-1 [Arabidopsis lyrata subsp. lyrata]
GI:15224918 RefSeq XP_002880126.1 122 mtACP-1 [Arabidopsis lyrata subsp. lyrata]
GI:15224918 RefSeq XP_010506390.1 122 PREDICTED: acyl carrier protein 1, mitochondrial [Camelina sativa]
GI:15224918 RefSeq XP_010508272.1 122 PREDICTED: acyl carrier protein 1, mitochondrial-like [Camelina sativa]