Gene/Proteome Database (LMPD)

LMPD ID
LMP009762
Gene ID
841900
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 2
Gene Symbol
ACP2
Synonyms
acyl carrier protein 2; T22H22.3; T22H22_3
Alternate Names
acyl carrier protein 2
Chromosome
1
Summary
encodes an acyl carrier protein expressed in leaves, roots, and dry seeds. Gene expression is not regulated by light but downregulated by starvation and upregulated by increased level of exogenous sucrose.
Orthologs
View orthologs and multiple alignments for ACP2

Proteins

acyl carrier protein 2
Refseq ID NP_175860
Protein GI 15221851
UniProt ID P25701
mRNA ID NM_104336
Length 136
RefSeq Status REVIEWED
MASIAASASISLQARPRQLAIAASQVKSFSNGRRSSLSFNLRQLPTRLTVSCAAKPETVDKVCAVVRKQLSLKEADEITAATKFAALGADSLDTVEIVMGLEEEFGIEMAEEKAQSIATVEQAAALIEELLFEKAK

Gene Information

Entrez Gene ID
841900
Gene Name
acyl carrier protein 2
Gene Symbol
ACP2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0000036 IDA:TAIR F ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
acyl carrier protein 2
Protein Entry
ACP2_ARATH
UniProt ID
P25701
Species
Arabidopsis

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Induction By sucrose in the dark. Down-regulated by starvation. {ECO:0000269|PubMed:11788768}.
Ptm 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by acpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group (By similarity). {ECO:0000250}.
Sequence Caution Sequence=CAB63798.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Contains 1 acyl carrier domain. {ECO:0000305}.
Subcellular Location Plastid, chloroplast.

Identical and Related Proteins

Unique RefSeq proteins for LMP009762 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15221851 RefSeq NP_175860 136 acyl carrier protein 2

Identical Sequences to LMP009762 proteins

Reference Database Accession Length Protein Name
GI:15221851 GenBank AAC64875.1 136 Identical to gb|L14814 DNA for tissue-specific acyl carrier protein isoform 2 from A. thaliana. ESTs gb|AA597351, gb|T41805, gb|H36871, gb|R30210, gb|AA042549, gb|Z47650, gb|H76304 and gb|AA597348 come from this gene [Arabidopsis thaliana]
GI:15221851 GenBank AAL32851.1 136 tissue-specific acyl carrier protein isoform 2 from A [Arabidopsis thaliana]
GI:15221851 GenBank AAM10223.1 136 acyl carrier protein isoform 2 [Arabidopsis thaliana]
GI:15221851 GenBank AEE33121.1 136 acyl carrier protein 2 [Arabidopsis thaliana]
GI:15221851 SwissProt P25701.2 136 RecName: Full=Acyl carrier protein 2, chloroplastic; Short=ACP-2; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009762 proteins

Reference Database Accession Length Protein Name
GI:15221851 EMBL CAB63798.1 154 acyl carrier protein [Arabidopsis thaliana]
GI:15221851 GenBank AAK96795.1 136 acyl carrier protein (ACP) gene [Arabidopsis thaliana]
GI:15221851 GenBank AAM65617.1 136 acyl-carrier protein (ACP), putative [Arabidopsis thaliana]
GI:15221851 GenBank EFH68163.1 136 hypothetical protein ARALYDRAFT_474734 [Arabidopsis lyrata subsp. lyrata]
GI:15221851 PRF - 136 acyl carrier protein 2 [Arabidopsis thaliana]
GI:15221851 RefSeq XP_002891904.1 136 hypothetical protein ARALYDRAFT_474734 [Arabidopsis lyrata subsp. lyrata]