Gene/Proteome Database (LMPD)

LMPD ID
LMP009763
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 2
Gene Symbol
Synonyms
mitochondrial acyl carrier protein 2; mtACP2; T8F5.6; T8F5_6
Alternate Names
acyl carrier protein 2
Chromosome
1
Summary
Encodes a member of the mitochondrial acyl carrier protein (ACP) family. As part of the mitochondrial matrix, it is likely to be involved in fatty acid or lipoic acid biogenesis.
Orthologs

Proteins

acyl carrier protein 2
Refseq ID NP_176708
Protein GI 15217894
UniProt ID O80800
mRNA ID NM_105202
Length 126
RefSeq Status REVIEWED
MAARGAMLRYLRVNVNPTIQNPRECVLPFSILLRRFSEEVRGSFLDKSEVTDRVLSVVKNFQKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEEFGFEIPDNEADKIQSIDLAVDFIASHPQAK

Gene Information

Entrez Gene ID
Gene Name
acyl carrier protein 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005759 IDA:TAIR C mitochondrial matrix
GO:0005739 IDA:TAIR C mitochondrion
GO:0070469 IEA:UniProtKB-KW C respiratory chain
GO:0050897 IDA:TAIR F cobalt ion binding
GO:0046872 IDA:TAIR F metal ion binding
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process
GO:0055114 IEA:UniProtKB-KW P oxidation-reduction process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00190 Oxidative phosphorylation
ko00190 Oxidative phosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
acyl carrier protein 2
Protein Entry
ACPM2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity). {ECO:0000250}.
Interaction Q39016:CPK11; NbExp=4; IntAct=EBI-2298689, EBI-979321;
Pathway Lipid metabolism; fatty acid biosynthesis.
Ptm 4'-phosphopantetheine is transferred from CoA to a specific serine of the apo-ACP-like protein. {ECO:0000305}.
Similarity Contains 1 acyl carrier domain. {ECO:0000305}.
Subcellular Location Mitochondrion {ECO:0000250}.
Subunit Complex I is composed of at least 49 different subunits.

Identical and Related Proteins

Unique RefSeq proteins for LMP009763 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15217894 RefSeq NP_176708 126 acyl carrier protein 2

Identical Sequences to LMP009763 proteins

Reference Database Accession Length Protein Name
GI:15217894 GenBank AAC27139.1 126 Similar to acyl carrier protein, mitochondrial precursor (ACP) NADH-ubiquinone oxidoreductase 9.6 KD subunit (MYACP-1), gb|L23574 from A. thaliana. ESTs gb|Z30712, gb|Z30713, gb|Z26204, gb|N37975 and gb|N96330 come from this gene [Arabidopsis thaliana]
GI:15217894 GenBank AEE34354.1 126 acyl carrier protein 2 [Arabidopsis thaliana]
GI:15217894 SwissProt O80800.1 126 RecName: Full=Acyl carrier protein 2, mitochondrial; AltName: Full=MtACP-2; Short=ACP; AltName: Full=NADH-ubiquinone oxidoreductase 9.6 kDa subunit; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009763 proteins

Reference Database Accession Length Protein Name
GI:15217894 GenBank AAM62469.1 126 acyl carrier protein, putative [Arabidopsis thaliana]
GI:15217894 GenBank EFH64593.1 126 hypothetical protein ARALYDRAFT_893919 [Arabidopsis lyrata subsp. lyrata]
GI:15217894 GenBank EOA35892.1 126 hypothetical protein CARUB_v10021149mg [Capsella rubella]
GI:15217894 RefSeq XP_002888334.1 126 hypothetical protein ARALYDRAFT_893919 [Arabidopsis lyrata subsp. lyrata]
GI:15217894 RefSeq XP_006302994.1 126 hypothetical protein CARUB_v10021149mg [Capsella rubella]
GI:15217894 RefSeq XP_010415071.1 126 PREDICTED: acyl carrier protein 2, mitochondrial [Camelina sativa]