Gene/Proteome Database (LMPD)

LMPD ID
LMP009876
Gene ID
842526
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
aspartic proteinase A2
Gene Symbol
AT1G62290
Synonyms
F19K23.21; F19K23_21
Alternate Names
aspartic proteinase A2
Chromosome
1
EC Number
3.4.23.-

Proteins

aspartic proteinase A2
Refseq ID NP_001031219
Protein GI 79320483
UniProt ID Q8VYL3
mRNA ID NM_001036142
Length 513
RefSeq Status REVIEWED
MGVYSRAVAFSVFVSFLLFFTAYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLRSYNNNLGGDSGDADIVPLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCYFHAKYKSSRSSTYKKSGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIETTSEPGLTFLVAKFDGLLGLGFQEIAVGNATPVWYNMLKQGLIKRPVFSFWLNRDPKSEEGGEIVFGGVDPKHFRGEHTFVPVTQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLLAGPTAVVAMINKAIGASGVVSQQCKTVVDQYGQTILDLLLAETQPKKICSQIGLCAYDGTHGVSMGIESVVDKENTRSSSGLRDAGCPACEMAVVWIQSQLRQNMTQERIVNYINEICERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEAV
aspartic proteinase A2
Refseq ID NP_176419
Protein GI 22330379
UniProt ID Q8VYL3
mRNA ID NM_104909
Length 513
RefSeq Status REVIEWED
Protein sequence is identical to GI:79320483 (mRNA isoform)

Gene Information

Entrez Gene ID
842526
Gene Name
aspartic proteinase A2
Gene Symbol
AT1G62290
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005773 IDA:TAIR C vacuole
GO:0004190 IEA:UniProtKB-KW F aspartic-type endopeptidase activity
GO:0006629 IEA:InterPro P lipid metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
6253768 Adaptive Immune System
6253763 Immune System
6254362 MHC class II antigen presentation

Domain Information

InterPro Annotations

Accession Description
IPR001461 Aspartic peptidase
IPR021109 Aspartic peptidase domain
IPR001969 Aspartic peptidase, active site
IPR008139 Saposin B
IPR011001 Saposin-like
IPR007856 Saposin-like type B, 1
IPR008138 Saposin-like type B, 2

UniProt Annotations

Entry Information

Gene Name
aspartic proteinase A2
Protein Entry
APA2_ARATH
UniProt ID
Q8VYL3
Species
Arabidopsis

Comments

Comment Type Description
Function Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles. {ECO:0000250}.
Sequence Caution Sequence=AAB60773.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the peptidase A1 family. {ECO:0000305}.
Similarity Contains 1 saposin B-type domain. {ECO:0000255|PROSITE-ProRule:PRU00415}.
Subcellular Location Vacuole {ECO:0000250}.
Tissue Specificity Expressed in seed pods and dry seeds. {ECO:0000269|PubMed:12230581}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009876 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
79320483 RefSeq NP_001031219 513 aspartic proteinase A2

Identical Sequences to LMP009876 proteins

Reference Database Accession Length Protein Name
GI:79320483 DBBJ BAH19961.1 513 AT1G62290 [Arabidopsis thaliana]
GI:79320483 GenBank AAN13225.1 513 putative aspartic protease [Arabidopsis thaliana]
GI:79320483 GenBank AEE33946.1 513 aspartic proteinase A2 [Arabidopsis thaliana]
GI:79320483 GenBank AEE33947.1 513 aspartic proteinase A2 [Arabidopsis thaliana]
GI:79320483 RefSeq NP_176419.2 513 aspartic proteinase A2 [Arabidopsis thaliana]
GI:79320483 SwissProt Q8VYL3.1 513 RecName: Full=Aspartic proteinase A2; AltName: Full=Aspartic protease 57; Short=AtASP57; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009876 proteins

Reference Database Accession Length Protein Name
GI:79320483 GenBank ADA48936.1 513 Sequence 26 from patent US 7622570
GI:79320483 GenBank EFH62740.1 513 aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
GI:79320483 RefSeq XP_002886481.1 513 aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
GI:79320483 RefSeq XP_010418211.1 514 PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
GI:79320483 RefSeq XP_010418212.1 514 PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
GI:79320483 RefSeq XP_010418213.1 514 PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]