Gene/Proteome Database (LMPD)
Proteins
| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
|---|---|
| Refseq ID | NP_680688 |
| Protein GI | 22328634 |
| UniProt ID | F4JIG1 |
| mRNA ID | NM_148322 |
| Length | 219 |
| RefSeq Status | REVIEWED |
| MATKITGVFILILTITFSSSSAVTATQQAPSSSPPVLTCTEELVMFSPCLPYVSSPPNNMSETPDPICCSVFTSSVHSSTGNCLCYLLRQPMILGFPLDRSRLISLSQICTDQNSEESFESLCSVSESPELPPLQSIQFTNPFVSGNNVSASPQSVDLAPEVSPSSDLFSPETATLAPPPPPPPLPVLQYFSSDSLKIRNFWFPSTIIMTFATSILARI | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
F4JIG1_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009910 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 22328634 | RefSeq | NP_680688 | 219 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP009910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22328634 | GenBank | AEE83502.1 | 219 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
Related Sequences to LMP009910 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22328634 | GenBank | EFH44508.1 | 215 | hypothetical protein ARALYDRAFT_493415 [Arabidopsis lyrata subsp. lyrata] |
| GI:22328634 | GenBank | EOA19098.1 | 214 | hypothetical protein CARUB_v10007766mg [Capsella rubella] |
| GI:22328634 | RefSeq | XP_002868249.1 | 215 | hypothetical protein ARALYDRAFT_493415 [Arabidopsis lyrata subsp. lyrata] |
| GI:22328634 | RefSeq | XP_006286200.1 | 214 | hypothetical protein CARUB_v10007766mg [Capsella rubella] |
| GI:22328634 | RefSeq | XP_010435063.1 | 220 | PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like [Camelina sativa] |
| GI:22328634 | RefSeq | XP_010449987.1 | 220 | PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like [Camelina sativa] |