Gene/Proteome Database (LMPD)

LMPD ID
LMP009910
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Chromosome
4

Proteins

bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Refseq ID NP_680688
Protein GI 22328634
UniProt ID F4JIG1
mRNA ID NM_148322
Length 219
RefSeq Status REVIEWED
MATKITGVFILILTITFSSSSAVTATQQAPSSSPPVLTCTEELVMFSPCLPYVSSPPNNMSETPDPICCSVFTSSVHSSTGNCLCYLLRQPMILGFPLDRSRLISLSQICTDQNSEESFESLCSVSESPELPPLQSIQFTNPFVSGNNVSASPQSVDLAPEVSPSSDLFSPETATLAPPPPPPPLPVLQYFSSDSLKIRNFWFPSTIIMTFATSILARI

Gene Information

Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain

UniProt Annotations

Entry Information

Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
F4JIG1_ARATH
UniProt ID
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP009910 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22328634 RefSeq NP_680688 219 bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

Identical Sequences to LMP009910 proteins

Reference Database Accession Length Protein Name
GI:22328634 GenBank AEE83502.1 219 bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana]

Related Sequences to LMP009910 proteins

Reference Database Accession Length Protein Name
GI:22328634 GenBank EFH44508.1 215 hypothetical protein ARALYDRAFT_493415 [Arabidopsis lyrata subsp. lyrata]
GI:22328634 GenBank EOA19098.1 214 hypothetical protein CARUB_v10007766mg [Capsella rubella]
GI:22328634 RefSeq XP_002868249.1 215 hypothetical protein ARALYDRAFT_493415 [Arabidopsis lyrata subsp. lyrata]
GI:22328634 RefSeq XP_006286200.1 214 hypothetical protein CARUB_v10007766mg [Capsella rubella]
GI:22328634 RefSeq XP_010435063.1 220 PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like [Camelina sativa]
GI:22328634 RefSeq XP_010449987.1 220 PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like [Camelina sativa]