Gene/Proteome Database (LMPD)
Proteins
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
---|---|
Refseq ID | NP_973749 |
Protein GI | 42571317 |
UniProt ID | F4HZB9 |
mRNA ID | NM_202020 |
Length | 171 |
RefSeq Status | REVIEWED |
MILAILALVIATFLYGGATTVQAGCRDTLTSLSPCLYYLNGGSSSPSWSCCRQFSTVVQSSPECLCSVVNSNESSFYGFKFNRTLALNLPTACNVQTPSPSLCNTGGNVPTTLPANTPVGSPRSAPSPSGTTSPANTPSGSKKFPLSNESSSKSNVIILSFVSIALVLAII |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
F4HZB9_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009929 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
42571317 | RefSeq | NP_973749 | 171 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP009929 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42571317 | GenBank | AEE27530.1 | 171 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
Related Sequences to LMP009929 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42571317 | GenBank | AAD25798.1 | 129 | F10O3.7 [Arabidopsis thaliana] |
GI:42571317 | GenBank | EFH65695.1 | 162 | hypothetical protein ARALYDRAFT_311412 [Arabidopsis lyrata subsp. lyrata] |
GI:42571317 | GenBank | ESQ36617.1 | 165 | hypothetical protein EUTSA_v10009479mg [Eutrema salsugineum] |
GI:42571317 | GenBank | ESW16643.1 | 186 | hypothetical protein PHAVU_007G173500g [Phaseolus vulgaris] |
GI:42571317 | RefSeq | XP_002889436.1 | 162 | hypothetical protein ARALYDRAFT_311412 [Arabidopsis lyrata subsp. lyrata] |
GI:42571317 | RefSeq | XP_006418264.1 | 165 | hypothetical protein EUTSA_v10009479mg [Eutrema salsugineum] |