Gene/Proteome Database (LMPD)
Proteins
| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein | |
|---|---|
| Refseq ID | NP_567445 |
| Protein GI | 18414320 |
| UniProt ID | Q2PE59 |
| mRNA ID | NM_117567 |
| Length | 156 |
| RefSeq Status | REVIEWED |
| MKPRMCLILFIALMRVMSIVSAQSSCTNVLISMAPCLSFITQNTSLPSQQCCNQLAHVVRYSSECLCQVLDGGGSQLGINVNETQALALPKACHVETPPASRCHSGSSVNSHSEHGNGSKTVPREKSSSDGSIKFSFPLLAILFTASYITLIYAKY | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0008233 | IEA:UniProtKB-KW | F | peptidase activity |
| GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein
Protein Entry
Q2PE59_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009938 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18414320 | RefSeq | NP_567445 | 156 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein |
Identical Sequences to LMP009938 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18414320 | DBBJ | BAE73270.1 | 156 | xylogen like protein 14 [Arabidopsis thaliana] |
| GI:18414320 | GenBank | ABE66067.1 | 156 | protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis thaliana] |
| GI:18414320 | GenBank | AEE83504.1 | 156 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein [Arabidopsis thaliana] |
Related Sequences to LMP009938 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18414320 | GenBank | AAM64671.1 | 156 | unknown [Arabidopsis thaliana] |
| GI:18414320 | GenBank | ABK28633.1 | 157 | unknown, partial [Arabidopsis thaliana] |
| GI:18414320 | GenBank | EFH46539.1 | 155 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18414320 | RefSeq | XP_002870280.1 | 155 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18414320 | RefSeq | XP_010440386.1 | 160 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |
| GI:18414320 | RefSeq | XP_010449986.1 | 160 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |