Gene/Proteome Database (LMPD)
LMPD ID
LMP010017
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidylglycerolphosphate synthase 2
Gene Symbol
Synonyms
phosphatidylglycerolphosphate synthase 2
Alternate Names
phosphatidylglycerolphosphate synthase 2
Chromosome
3
EC Number
2.7.8.5
Summary
Encodes a phosphatidylglycerolphosphate synthase.
Orthologs
Proteins
| phosphatidylglycerolphosphate synthase 2 | |
|---|---|
| Refseq ID | NP_191063 |
| Protein GI | 15233163 |
| UniProt ID | Q9M2W3 |
| mRNA ID | NM_115361 |
| Length | 233 |
| RefSeq Status | REVIEWED |
| MGEEDTATVDQNSFGGGKDSLLRNRHSSPLPSPTQLSSKVITLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGSEFGAFLDPVADKLMVAATLILLCTKPMVAVVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALTILLASRDSSFERLLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLLKK | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylglycerolphosphate synthase 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043231 | IDA:TAIR | C | intracellular membrane-bounded organelle |
| GO:0008444 | IDA:TAIR | F | CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity |
| GO:0030145 | IDA:UniProtKB | F | manganese ion binding |
| GO:0006655 | IEA:UniProtKB-UniPathway | P | phosphatidylglycerol biosynthetic process |
KEGG Pathway Links
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylglycerolphosphate synthase 2
Protein Entry
PGPS2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=62 uM for glycerol-3-phosphate {ECO:0000269|PubMed:11741606}; KM=17 uM for CDP-dipalmitoylglycerol {ECO:0000269|PubMed:11741606}; pH dependence: Optimum pH is 8.5. {ECO:0000269|PubMed:11741606}; |
| Catalytic Activity | CDP-diacylglycerol + sn-glycerol 3-phosphate = CMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate. {ECO:0000269|PubMed:11741606}. |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000269|PubMed:11741606}; |
| Function | This protein catalyzes the committed step to the synthesis of the acidic phospholipids. {ECO:0000269|PubMed:11741606}. |
| Pathway | Phospholipid metabolism; phosphatidylglycerol biosynthesis; phosphatidylglycerol from CDP-diacylglycerol: step 1/2. |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}. |
| Subcellular Location | Microsome membrane {ECO:0000305|PubMed:11741606}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010017 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15233163 | RefSeq | NP_191063 | 233 | phosphatidylglycerolphosphate synthase 2 |
Identical Sequences to LMP010017 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15233163 | EMBL | CAV21574.1 | 233 | unnamed protein product [Arabidopsis thaliana] |
| GI:15233163 | EMBL | CAY37209.1 | 233 | unnamed protein product [Arabidopsis thaliana] |
| GI:15233163 | GenBank | AAK44001.1 | 233 | putative phosphatidylglycerophosphate synthase [Arabidopsis thaliana] |
| GI:15233163 | GenBank | AAL15250.1 | 233 | putative phosphatidylglycerophosphate synthase [Arabidopsis thaliana] |
| GI:15233163 | GenBank | AEE79330.1 | 233 | phosphatidylglycerolphosphate synthase 2 [Arabidopsis thaliana] |
| GI:15233163 | SwissProt | Q9M2W3.1 | 233 | RecName: Full=CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2; AltName: Full=Phosphatidylglycerophosphate synthase 2; Short=PGP synthase 2 [Arabidopsis thaliana] |
Related Sequences to LMP010017 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15233163 | GenBank | EFH52542.1 | 233 | hypothetical protein ARALYDRAFT_906919 [Arabidopsis lyrata subsp. lyrata] |
| GI:15233163 | GenBank | EOA25129.1 | 235 | hypothetical protein CARUB_v10018438mg [Capsella rubella] |
| GI:15233163 | GenBank | ESQ44952.1 | 234 | hypothetical protein EUTSA_v10010682mg [Eutrema salsugineum] |
| GI:15233163 | RefSeq | XP_002876283.1 | 233 | hypothetical protein ARALYDRAFT_906919 [Arabidopsis lyrata subsp. lyrata] |
| GI:15233163 | RefSeq | XP_006292231.1 | 235 | hypothetical protein CARUB_v10018438mg [Capsella rubella] |
| GI:15233163 | RefSeq | XP_006403499.1 | 234 | hypothetical protein EUTSA_v10010682mg [Eutrema salsugineum] |