Gene/Proteome Database (LMPD)

LMPD ID
LMP010017
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidylglycerolphosphate synthase 2
Gene Symbol
Synonyms
phosphatidylglycerolphosphate synthase 2
Alternate Names
phosphatidylglycerolphosphate synthase 2
Chromosome
3
EC Number
2.7.8.5
Summary
Encodes a phosphatidylglycerolphosphate synthase.
Orthologs

Proteins

phosphatidylglycerolphosphate synthase 2
Refseq ID NP_191063
Protein GI 15233163
UniProt ID Q9M2W3
mRNA ID NM_115361
Length 233
RefSeq Status REVIEWED
MGEEDTATVDQNSFGGGKDSLLRNRHSSPLPSPTQLSSKVITLPTVLTLGRVAAVPILVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGSEFGAFLDPVADKLMVAATLILLCTKPMVAVVLGPVPWLVTVPSIAIIGREITMSAVREWAASQNGKLSEAVAVNSLGKWKTATQMIALTILLASRDSSFERLLPSGIGLLYVSAGLSIWSLVVYMRKIWRVLLKK

Gene Information

Entrez Gene ID
Gene Name
phosphatidylglycerolphosphate synthase 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009941 IDA:TAIR C chloroplast envelope
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:TAIR C intracellular membrane-bounded organelle
GO:0008444 IDA:TAIR F CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity
GO:0030145 IDA:UniProtKB F manganese ion binding
GO:0006655 IEA:UniProtKB-UniPathway P phosphatidylglycerol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00564 Glycerophospholipid metabolism
ath01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY4FS-7 phosphatidylglycerol biosynthesis I (plastidic)
PWY4FS-8 phosphatidylglycerol biosynthesis II (non-plastidic)

Domain Information

InterPro Annotations

Accession Description
IPR000462 CDP-alcohol phosphatidyltransferase
IPR004570 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

UniProt Annotations

Entry Information

Gene Name
phosphatidylglycerolphosphate synthase 2
Protein Entry
PGPS2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=62 uM for glycerol-3-phosphate {ECO:0000269|PubMed:11741606}; KM=17 uM for CDP-dipalmitoylglycerol {ECO:0000269|PubMed:11741606}; pH dependence: Optimum pH is 8.5. {ECO:0000269|PubMed:11741606};
Catalytic Activity CDP-diacylglycerol + sn-glycerol 3-phosphate = CMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate. {ECO:0000269|PubMed:11741606}.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000269|PubMed:11741606};
Function This protein catalyzes the committed step to the synthesis of the acidic phospholipids. {ECO:0000269|PubMed:11741606}.
Pathway Phospholipid metabolism; phosphatidylglycerol biosynthesis; phosphatidylglycerol from CDP-diacylglycerol: step 1/2.
Similarity Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}.
Subcellular Location Microsome membrane {ECO:0000305|PubMed:11741606}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010017 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15233163 RefSeq NP_191063 233 phosphatidylglycerolphosphate synthase 2

Identical Sequences to LMP010017 proteins

Reference Database Accession Length Protein Name
GI:15233163 EMBL CAV21574.1 233 unnamed protein product [Arabidopsis thaliana]
GI:15233163 EMBL CAY37209.1 233 unnamed protein product [Arabidopsis thaliana]
GI:15233163 GenBank AAK44001.1 233 putative phosphatidylglycerophosphate synthase [Arabidopsis thaliana]
GI:15233163 GenBank AAL15250.1 233 putative phosphatidylglycerophosphate synthase [Arabidopsis thaliana]
GI:15233163 GenBank AEE79330.1 233 phosphatidylglycerolphosphate synthase 2 [Arabidopsis thaliana]
GI:15233163 SwissProt Q9M2W3.1 233 RecName: Full=CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2; AltName: Full=Phosphatidylglycerophosphate synthase 2; Short=PGP synthase 2 [Arabidopsis thaliana]

Related Sequences to LMP010017 proteins

Reference Database Accession Length Protein Name
GI:15233163 GenBank EFH52542.1 233 hypothetical protein ARALYDRAFT_906919 [Arabidopsis lyrata subsp. lyrata]
GI:15233163 GenBank EOA25129.1 235 hypothetical protein CARUB_v10018438mg [Capsella rubella]
GI:15233163 GenBank ESQ44952.1 234 hypothetical protein EUTSA_v10010682mg [Eutrema salsugineum]
GI:15233163 RefSeq XP_002876283.1 233 hypothetical protein ARALYDRAFT_906919 [Arabidopsis lyrata subsp. lyrata]
GI:15233163 RefSeq XP_006292231.1 235 hypothetical protein CARUB_v10018438mg [Capsella rubella]
GI:15233163 RefSeq XP_006403499.1 234 hypothetical protein EUTSA_v10010682mg [Eutrema salsugineum]