Gene/Proteome Database (LMPD)

LMPD ID
LMP010142
Gene ID
820984
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
dihydrolipoyl dehydrogenase 2
Gene Symbol
mtLPD2
Synonyms
lipoamide dehydrogenase 2; LIPOAMIDE DEHYDROGENASE 2; mtLPD2
Alternate Names
dihydrolipoyl dehydrogenase 2
Chromosome
3
EC Number
1.8.1.4
Summary
lipoamide dehydrogenase precursor
Orthologs
View orthologs and multiple alignments for mtLPD2

Proteins

dihydrolipoyl dehydrogenase 2
Refseq ID NP_566570
Protein GI 30684428
UniProt ID Q9M5K2
mRNA ID NM_112601
Length 507
RefSeq Status REVIEWED
MAMASLARRKAYFLTRNISNSPTDAFRFSFSLTRGFASSGSDDNDVVIIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSPSEVSVDTIDGENVVVKGKHIIVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVWGRLGSEVTVVEFAADIVPAMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGEQTTLEADVVLVSAGRTPFTSGLDLEKIGVETDKGGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVASVGKTEEQLKKEGVSYNVGKFPFMANSRAKAIDTAEGMVKILADKETDKILGVHIMSPNAGELIHEAVLAINYDASSEDIARVCHAHPTMSEAIKEAAMATYDKPIHM
dihydrolipoyl dehydrogenase 2
Refseq ID NP_851005
Protein GI 30684419
UniProt ID Q9M5K2
mRNA ID NM_180674
Length 507
RefSeq Status REVIEWED
Protein sequence is identical to GI:30684428 (mRNA isoform)
dihydrolipoyl dehydrogenase 2
Refseq ID NP_566571
Protein GI 18401438
UniProt ID Q9M5K2
mRNA ID NM_112602
Length 127
RefSeq Status REVIEWED
MAMASLARRKAYFLTRNISNSPTDAFRFSFSLTRGFASSGSDDNDVVIIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKVILETPFPITLIRRKFSPIFIRLLWNLLVDHHLDSI

Gene Information

Entrez Gene ID
820984
Gene Name
dihydrolipoyl dehydrogenase 2
Gene Symbol
mtLPD2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IDA:TAIR C apoplast
GO:0009507 IDA:TAIR C chloroplast
GO:0005747 IDA:TAIR C mitochondrial respiratory chain complex I
GO:0005739 IDA:TAIR C mitochondrion
GO:0005524 IDA:TAIR F ATP binding
GO:0050897 IDA:TAIR F cobalt ion binding
GO:0005507 IDA:TAIR F copper ion binding
GO:0004148 IMP:TAIR F dihydrolipoyl dehydrogenase activity
GO:0050660 IEA:InterPro F flavin adenine dinucleotide binding
GO:0008270 IDA:TAIR F zinc ion binding
GO:0045454 IEA:InterPro P cell redox homeostasis
GO:0046686 IEP:TAIR P response to cadmium ion

KEGG Pathway Links

KEGG Pathway ID Description
ath01200 Carbon metabolism
ath00020 Citrate cycle (TCA cycle)
ath00260 Glycine, serine and threonine metabolism
ath00010 Glycolysis / Gluconeogenesis

Domain Information

InterPro Annotations

Accession Description
IPR006258 Dihydrolipoamide dehydrogenase
IPR013027 FAD-dependent pyridine nucleotide-disulphide oxidoreductase
IPR016156 FAD/NAD-linked reductase, dimerisation domain
IPR023753 Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain
IPR001327 Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain
IPR012999 Pyridine nucleotide-disulphide oxidoreductase, class I, active site
IPR004099 Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

UniProt Annotations

Entry Information

Gene Name
dihydrolipoyl dehydrogenase 2
Protein Entry
DLDH2_ARATH
UniProt ID
Q9M5K2
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9M5K2-1; Sequence=Displayed; Name=2; IsoId=Q9M5K2-2; Sequence=VSP_021588, VSP_021589; Note=May be due to an intron retention. No experimental confirmation available.;
Catalytic Activity Protein N(6)-(dihydrolipoyl)lysine + NAD(+) = protein N(6)-(lipoyl)lysine + NADH.
Cofactor Name=FAD; Xref=ChEBI:CHEBI:57692; Evidence={ECO:0000250}; Note=Binds 1 FAD per subunit. {ECO:0000250};
Disruption Phenotype No visible phenotype, probably due to redundancy with LPD1. {ECO:0000269|PubMed:11598235}.
Function Lipoamide dehydrogenase is a component of the glycine decarboxylase (GDC) or glycine cleavage system as well as of the alpha-ketoacid dehydrogenase complexes. LPD1 is probably the protein most often associated with the glycine decarboxylase complex while LPD2 is probably incorporated into alpha-ketoacid dehydrogenase complexes. {ECO:0000269|PubMed:11598235, ECO:0000269|PubMed:14764908}.
Miscellaneous The active site is a redox-active disulfide bond.
Ptm S-nytrosylated at unknown positions.
Similarity Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. {ECO:0000305}.
Subcellular Location Mitochondrion matrix {ECO:0000269|PubMed:14671022, ECO:0000269|PubMed:14764908}.
Subunit Homodimer (By similarity). Part of both the glycine cleavage system composed of four proteins: P, T, L and H and of the pyruvate dehydrogenase complex containing multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). {ECO:0000250}.
Tissue Specificity Preferentially expressed in roots, flowers and siliques and at a lower level in stems and leaves. {ECO:0000269|PubMed:11598235}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010142 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30684428 RefSeq NP_566570 507 dihydrolipoyl dehydrogenase 2
18401438 RefSeq NP_566571 127 dihydrolipoyl dehydrogenase 2

Identical Sequences to LMP010142 proteins

Reference Database Accession Length Protein Name
GI:30684428 GenBank AAF34796.1 507 lipoamide dehydrogenase precursor [Arabidopsis thaliana]
GI:18401438 GenBank AAM64759.1 127 lipoamide dehydrogenase precursor [Arabidopsis thaliana]
GI:18401438 GenBank ABD38917.1 127 At3g17240 [Arabidopsis thaliana]
GI:30684428 GenBank ADT60169.1 507 Sequence 1228 from patent US 7847156
GI:30684428 GenBank AEE75925.1 507 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:18401438 GenBank AEE75926.1 127 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:30684428 GenBank AEE75927.1 507 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:30684428 RefSeq NP_851005.1 507 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:30684428 SwissProt Q9M5K2.1 507 RecName: Full=Dihydrolipoyl dehydrogenase 2, mitochondrial; Short=AtmLPD2; Short=mtLPD2; AltName: Full=Dihydrolipoamide dehydrogenase 2; AltName: Full=Glycine cleavage system L protein 2; AltName: Full=Pyruvate dehydrogenase complex E3 subunit 2; Short=E3-2; Short=PDC-E3 2; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010142 proteins

Reference Database Accession Length Protein Name
GI:18401438 GenBank AAF34796.1 507 lipoamide dehydrogenase precursor [Arabidopsis thaliana]
GI:30684428 GenBank EFH61454.1 507 hypothetical protein ARALYDRAFT_898058 [Arabidopsis lyrata subsp. lyrata]
GI:18401438 GenBank ADT60169.1 507 Sequence 1228 from patent US 7847156
GI:18401438 GenBank AEE75925.1 507 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:18401438 GenBank AEE75927.1 507 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:30684428 GenBank EOA30305.1 533 hypothetical protein CARUB_v10013431mg, partial [Capsella rubella]
GI:18401438 RefSeq NP_566570.3 507 dihydrolipoyl dehydrogenase 2 [Arabidopsis thaliana]
GI:30684428 RefSeq XP_002885195.1 507 hypothetical protein ARALYDRAFT_898058 [Arabidopsis lyrata subsp. lyrata]
GI:30684428 RefSeq XP_006297407.1 533 hypothetical protein CARUB_v10013431mg, partial [Capsella rubella]
GI:30684428 RefSeq XP_010505177.1 507 PREDICTED: dihydrolipoyl dehydrogenase 2, mitochondrial [Camelina sativa]
GI:30684428 RefSeq XP_010465754.1 507 PREDICTED: dihydrolipoyl dehydrogenase 2, mitochondrial-like [Camelina sativa]
GI:18401438 SwissProt Q9M5K2.1 507 RecName: Full=Dihydrolipoyl dehydrogenase 2, mitochondrial; Short=AtmLPD2; Short=mtLPD2; AltName: Full=Dihydrolipoamide dehydrogenase 2; AltName: Full=Glycine cleavage system L protein 2; AltName: Full=Pyruvate dehydrogenase complex E3 subunit 2; Short=E3-2; Short=PDC-E3 2; Flags: Precursor [Arabidopsis thaliana]