Gene/Proteome Database (LMPD)

LMPD ID
LMP010199
Gene ID
821175
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glycerophosphodiester phosphodiesterase 1
Gene Symbol
SRG3
Synonyms
F1C9.18; F1C9_18; senescence-related gene 3; SRG3
Alternate Names
glycerophosphodiester phosphodiesterase 1
Chromosome
3
EC Number
3.1.4.46

Proteins

glycerophosphodiester phosphodiesterase 1
Refseq ID NP_566159
Protein GI 18396047
UniProt ID Q9SGA2
mRNA ID NM_111070
Length 361
RefSeq Status REVIEWED
MSLKAIHVSEVPSLDHFPENPSLICSSRKANNKFVVVGHRGHGMNMSQSPDLRFSALKENSILSFNAASKFPLDFIEFDVQVTRDGCPIIFHDDFIYSEEQGVVYEKRVTEVCLSEFMSYGPQRDTGKTGKPLLRKSKEGKIHKWSVATDDSFCTLQEAFEKVENPNLGFNIELKLDDNVFYSSDHLSRLLLPILQVVSDIGNDRTIIFSSFHPDAALLVRKLQTTYPVFFLTNGGTEMYHDTRRNSLEEAIKVCLEGGLQGIVSEVKGVFRNPALVNKIKESKLSLMTYGKLNNVAEAVYMQHLMGIEGVIVDHVEEITEAVREMMKPSNRDADGTKPKPNFSDRELSFLLKLIPELIQH

Gene Information

Entrez Gene ID
821175
Gene Name
glycerophosphodiester phosphodiesterase 1
Gene Symbol
SRG3
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009536 IDA:TAIR C plastid
GO:0008889 IDA:TAIR F glycerophosphodiester phosphodiesterase activity
GO:0030643 IMP:TAIR P cellular phosphate ion homeostasis
GO:0006629 IEA:InterPro P lipid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY0-381 glycerol and glycerophosphodiester degradation

REACTOME Pathway Links

REACTOME Pathway ID Description
6253801 Glycerophospholipid biosynthesis
6254319 Hydrolysis of LPC
6254318 Hydrolysis of LPE

Domain Information

InterPro Annotations

Accession Description
IPR017946 PLC-like phosphodiesterase, TIM beta/alpha-barrel domain

UniProt Annotations

Entry Information

Gene Name
glycerophosphodiester phosphodiesterase 1
Protein Entry
GDPD1_ARATH
UniProt ID
Q9SGA2
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: Vmax=13.1 umol/min/mg enzyme toward glycerolphosphoglycerol {ECO:0000269|PubMed:21323773}; Vmax=12.4 umol/min/mg enzyme toward glycerophosphocholine {ECO:0000269|PubMed:21323773}; Vmax=10.1 umol/min/mg enzyme toward glycerophosphoethanolamine {ECO:0000269|PubMed:21323773};
Catalytic Activity A glycerophosphodiester + H(2)O = an alcohol + sn-glycerol 3-phosphate. {ECO:0000269|PubMed:21323773}.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:21323773};
Disruption Phenotype No visible phenotype under normal growth conditions, but mutant plants show reduced glycerophosphodiester phosphodiesterase activity under phosphate starvation. {ECO:0000269|PubMed:21323773}.
Function Hydrolyzes glycerolphosphoglycerol, glycerophosphocholine and glycerophosphoethanolamine in vitro. May be involved in release of inorganic phosphate (Pi) from phospholipids during Pi starvation. {ECO:0000269|PubMed:21323773}.
Induction By senescence (PubMed:8883383) and phosphate starvation (PubMed:21323773). {ECO:0000269|PubMed:21323773, ECO:0000269|PubMed:8883383}.
Similarity Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}.
Similarity Contains 1 GP-PDE domain. {ECO:0000255}.
Subcellular Location Plastid, chloroplast {ECO:0000269|PubMed:21323773}.
Tissue Specificity Expressed in roots, shoots, rosette leaves, stems, flowers and siliques. {ECO:0000269|PubMed:21323773}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010199 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18396047 RefSeq NP_566159 361 glycerophosphodiester phosphodiesterase 1

Identical Sequences to LMP010199 proteins

Reference Database Accession Length Protein Name
GI:18396047 GenBank AAF14831.1 361 hypothetical protein [Arabidopsis thaliana]
GI:18396047 GenBank AAL59949.1 361 unknown protein [Arabidopsis thaliana]
GI:18396047 GenBank AAM45121.1 361 unknown protein [Arabidopsis thaliana]
GI:18396047 GenBank AEE73752.1 361 glycerophosphodiester phosphodiesterase 1 [Arabidopsis thaliana]
GI:18396047 SwissProt Q9SGA2.1 361 RecName: Full=Glycerophosphodiester phosphodiesterase GDPD1, chloroplastic; AltName: Full=Glycerophosphodiester phosphodiesterase 1; Short=AtGDPD1; AltName: Full=Protein SENESCENCE-RELATED GENE 3; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010199 proteins

Reference Database Accession Length Protein Name
GI:18396047 GenBank AAO29946.1 361 expressed protein [Arabidopsis thaliana]
GI:18396047 GenBank EOA30888.1 361 hypothetical protein CARUB_v10014033mg [Capsella rubella]
GI:18396047 RefSeq XP_006297990.1 361 hypothetical protein CARUB_v10014033mg [Capsella rubella]
GI:18396047 RefSeq XP_006408568.1 359 hypothetical protein EUTSA_v10021007mg [Eutrema salsugineum]
GI:18396047 RefSeq XP_010496414.1 362 PREDICTED: glycerophosphodiester phosphodiesterase GDPD1, chloroplastic [Camelina sativa]
GI:18396047 RefSeq XP_010496891.1 363 PREDICTED: glycerophosphodiester phosphodiesterase GDPD1, chloroplastic-like [Camelina sativa]