Gene/Proteome Database (LMPD)
Proteins
phospholipase C/ phosphoric diester hydrolase | |
---|---|
Refseq ID | NP_172824 |
Protein GI | 186478451 |
UniProt ID | Q9LMX9 |
mRNA ID | NM_101237 |
Length | 346 |
RefSeq Status | REVIEWED |
MASFKFFFAAIILVLFHPAAITFVASYGSLQLGDQCSSDEDCNVGLGCFKCGIDVARCVRSNITDQFSIVNNSMPFNKYAFLTTHNSYAIEGKALHVATQEDTIVQQLNSGVRALMLDTYDYEGDVWFCHSFDEQCFEFTKFNRAIDTFKEIFAFLTANPSEIVTLILEDYVKSQNGLTKVFTDSGLKKFWFPVQNMPIGGQDWPLVKDMVANNHRLIVFTSAKSKQETEGIAYQWNYMVENQYGDDGVKPDECSNRADSALLTDKTKALVSVNHFKTVPVKILTCEENSEQLLDMIKTCYVAAGNRWANFVAVNFYKRSNGGGTFQAIDKLNGELLCGRDDVHAC |
Gene Information
Entrez Gene ID
Gene Name
phospholipase C/ phosphoric diester hydrolase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008081 | IEA:InterPro | F | phosphoric diester hydrolase activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase C/ phosphoric diester hydrolase
Protein Entry
Q9LMX9_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP010200 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
186478451 | RefSeq | NP_172824 | 346 | phospholipase C/ phosphoric diester hydrolase |
Identical Sequences to LMP010200 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:186478451 | GenBank | AAF81295.1 | 346 | Contains similarity to MAP3K-like protein kinase from Arabidopsis thaliana gb|Z99707 [Arabidopsis thaliana] |
GI:186478451 | GenBank | ACW94942.1 | 346 | Sequence 14331 from patent US 7569389 |
GI:186478451 | GenBank | AEE29057.1 | 346 | phospholipase C/ phosphoric diester hydrolase [Arabidopsis thaliana] |
Related Sequences to LMP010200 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:186478451 | GenBank | EFH66275.1 | 346 | hypothetical protein ARALYDRAFT_334664 [Arabidopsis lyrata subsp. lyrata] |
GI:186478451 | GenBank | EOA39071.1 | 348 | hypothetical protein CARUB_v10011738mg [Capsella rubella] |
GI:186478451 | GenBank | ESQ35453.1 | 346 | hypothetical protein EUTSA_v10009757mg [Eutrema salsugineum] |
GI:186478451 | RefSeq | XP_002890016.1 | 346 | hypothetical protein ARALYDRAFT_334664 [Arabidopsis lyrata subsp. lyrata] |
GI:186478451 | RefSeq | XP_006306173.1 | 348 | hypothetical protein CARUB_v10011738mg [Capsella rubella] |
GI:186478451 | RefSeq | XP_006417100.1 | 346 | hypothetical protein EUTSA_v10009757mg [Eutrema salsugineum] |