Gene/Proteome Database (LMPD)

LMPD ID
LMP010214
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
palmitate desaturase
Gene Symbol
Synonyms
F10M23.370; F10M23_370; FAD4; FADA; FATTY ACID DESATURASE 4; fatty acid desaturase A
Alternate Names
palmitate desaturase
Chromosome
4
EC Number
1.14.19.-
Summary
Encodes an unusual palmitate desaturase that is highly substrate specific. It introduces a delta-3 trans double bond at palmitate at the sn-2 position of phosphatidylglycerol.
Orthologs

Proteins

palmitate desaturase
Refseq ID NP_194433
Protein GI 15236949
UniProt ID Q9SZ42
mRNA ID NM_118837
Length 323
RefSeq Status REVIEWED
MAVSLPTKYPLRPITNIPKSHRPSLLRVRVTCSVTTTKPQPNREKLLVEQRTVNLPLSNDQSLQSTKPRPNREKLVVEQRLASPPLSNDPTLKSTWTHRLWVAAGCTTLFVSLAKSVIGGFDSHLCLEPALAGYAGYILADLGSGVYHWAIDNYGDESTPVVGTQIEAFQGHHKWPWTITRRQFANNLHALAQVITFTVLPLDLAFNDPVFHGFVCTFAFCILFSQQFHAWAHGTKSKLPPLVVALQDMGLLVSRRQHAEHHRAPYNNNYCIVSGAWNNVLDESKVFEALEMVFYFQLGVRPRSWSEPNSDWIEETEISNNQA

Gene Information

Entrez Gene ID
Gene Name
palmitate desaturase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0031969 IDA:UniProtKB C chloroplast membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0052637 IMP:TAIR F delta 3-trans-hexadecenoic acid phosphatidylglycerol desaturase activity
GO:0046471 IMP:TAIR P phosphatidylglycerol metabolic process
GO:0080167 IEP:TAIR P response to karrikin
GO:0006636 IMP:TAIR P unsaturated fatty acid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR019547 B-domain containing protein Kua

UniProt Annotations

Entry Information

Gene Name
palmitate desaturase
Protein Entry
FAD4_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype Missing a chloroplast-specific phosphatidylglycerol molecular species that carries a delta 3- trans-hexadecenoic acid in the sn-2 position of its core glyceryl moiety. {ECO:0000269|PubMed:17796728, ECO:0000269|PubMed:19682287}.
Function Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species. Catalyzes the formation of a trans double bond introduced close to the carboxyl group of palmitic acid, which is specifically esterified to the sn-2 glyceryl carbon of phosphatidylglycerol. {ECO:0000269|PubMed:17796728, ECO:0000269|PubMed:19682287}.
Pathway Lipid metabolism; fatty acid metabolism.
Sequence Caution Sequence=AAK63863.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast membrane {ECO:0000269|PubMed:19682287}; Multi-pass membrane protein {ECO:0000269|PubMed:19682287}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010214 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15236949 RefSeq NP_194433 323 palmitate desaturase

Identical Sequences to LMP010214 proteins

Reference Database Accession Length Protein Name
GI:15236949 EMBL CAB36549.1 323 putative protein [Arabidopsis thaliana]
GI:15236949 EMBL CAB79558.1 323 putative protein [Arabidopsis thaliana]
GI:15236949 GenBank AEE85286.1 323 fatty acid desaturase A [Arabidopsis thaliana]
GI:15236949 SwissProt Q9SZ42.1 323 RecName: Full=Fatty acid desaturase 4, chloroplastic; AltName: Full=Fatty acid desaturase A; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010214 proteins

Reference Database Accession Length Protein Name
GI:15236949 GenBank EFH45841.1 323 hypothetical protein ARALYDRAFT_492093 [Arabidopsis lyrata subsp. lyrata]
GI:15236949 RefSeq XP_002869582.1 323 hypothetical protein ARALYDRAFT_492093 [Arabidopsis lyrata subsp. lyrata]
GI:15236949 RefSeq XP_006285104.1 313 hypothetical protein CARUB_v10006437mg [Capsella rubella]
GI:15236949 RefSeq XP_010433413.1 321 PREDICTED: fatty acid desaturase 4, chloroplastic isoform X1 [Camelina sativa]
GI:15236949 RefSeq XP_010433414.1 321 PREDICTED: fatty acid desaturase 4, chloroplastic isoform X2 [Camelina sativa]
GI:15236949 RefSeq XP_010438664.1 321 PREDICTED: fatty acid desaturase 4, chloroplastic-like [Camelina sativa]