Gene/Proteome Database (LMPD)
LMPD ID
LMP010214
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
palmitate desaturase
Gene Symbol
Synonyms
F10M23.370; F10M23_370; FAD4; FADA; FATTY ACID DESATURASE 4; fatty acid desaturase A
Alternate Names
palmitate desaturase
Chromosome
4
EC Number
1.14.19.-
Summary
Encodes an unusual palmitate desaturase that is highly substrate specific. It introduces a delta-3 trans double bond at palmitate at the sn-2 position of phosphatidylglycerol.
Orthologs
Proteins
| palmitate desaturase | |
|---|---|
| Refseq ID | NP_194433 |
| Protein GI | 15236949 |
| UniProt ID | Q9SZ42 |
| mRNA ID | NM_118837 |
| Length | 323 |
| RefSeq Status | REVIEWED |
| MAVSLPTKYPLRPITNIPKSHRPSLLRVRVTCSVTTTKPQPNREKLLVEQRTVNLPLSNDQSLQSTKPRPNREKLVVEQRLASPPLSNDPTLKSTWTHRLWVAAGCTTLFVSLAKSVIGGFDSHLCLEPALAGYAGYILADLGSGVYHWAIDNYGDESTPVVGTQIEAFQGHHKWPWTITRRQFANNLHALAQVITFTVLPLDLAFNDPVFHGFVCTFAFCILFSQQFHAWAHGTKSKLPPLVVALQDMGLLVSRRQHAEHHRAPYNNNYCIVSGAWNNVLDESKVFEALEMVFYFQLGVRPRSWSEPNSDWIEETEISNNQA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0031969 | IDA:UniProtKB | C | chloroplast membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0052637 | IMP:TAIR | F | delta 3-trans-hexadecenoic acid phosphatidylglycerol desaturase activity |
| GO:0046471 | IMP:TAIR | P | phosphatidylglycerol metabolic process |
| GO:0080167 | IEP:TAIR | P | response to karrikin |
| GO:0006636 | IMP:TAIR | P | unsaturated fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019547 | B-domain containing protein Kua |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | Missing a chloroplast-specific phosphatidylglycerol molecular species that carries a delta 3- trans-hexadecenoic acid in the sn-2 position of its core glyceryl moiety. {ECO:0000269|PubMed:17796728, ECO:0000269|PubMed:19682287}. |
| Function | Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species. Catalyzes the formation of a trans double bond introduced close to the carboxyl group of palmitic acid, which is specifically esterified to the sn-2 glyceryl carbon of phosphatidylglycerol. {ECO:0000269|PubMed:17796728, ECO:0000269|PubMed:19682287}. |
| Pathway | Lipid metabolism; fatty acid metabolism. |
| Sequence Caution | Sequence=AAK63863.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast membrane {ECO:0000269|PubMed:19682287}; Multi-pass membrane protein {ECO:0000269|PubMed:19682287}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010214 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15236949 | RefSeq | NP_194433 | 323 | palmitate desaturase |
Identical Sequences to LMP010214 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15236949 | EMBL | CAB36549.1 | 323 | putative protein [Arabidopsis thaliana] |
| GI:15236949 | EMBL | CAB79558.1 | 323 | putative protein [Arabidopsis thaliana] |
| GI:15236949 | GenBank | AEE85286.1 | 323 | fatty acid desaturase A [Arabidopsis thaliana] |
| GI:15236949 | SwissProt | Q9SZ42.1 | 323 | RecName: Full=Fatty acid desaturase 4, chloroplastic; AltName: Full=Fatty acid desaturase A; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010214 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15236949 | GenBank | EFH45841.1 | 323 | hypothetical protein ARALYDRAFT_492093 [Arabidopsis lyrata subsp. lyrata] |
| GI:15236949 | RefSeq | XP_002869582.1 | 323 | hypothetical protein ARALYDRAFT_492093 [Arabidopsis lyrata subsp. lyrata] |
| GI:15236949 | RefSeq | XP_006285104.1 | 313 | hypothetical protein CARUB_v10006437mg [Capsella rubella] |
| GI:15236949 | RefSeq | XP_010433413.1 | 321 | PREDICTED: fatty acid desaturase 4, chloroplastic isoform X1 [Camelina sativa] |
| GI:15236949 | RefSeq | XP_010433414.1 | 321 | PREDICTED: fatty acid desaturase 4, chloroplastic isoform X2 [Camelina sativa] |
| GI:15236949 | RefSeq | XP_010438664.1 | 321 | PREDICTED: fatty acid desaturase 4, chloroplastic-like [Camelina sativa] |