Gene/Proteome Database (LMPD)
LMPD ID
LMP010216
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Gene Symbol
Synonyms
T20K9.10; T20K9_10
Alternate Names
Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Chromosome
2
EC Number
1.14.19.-
Proteins
| Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein | |
|---|---|
| Refseq ID | NP_179874 |
| Protein GI | 15227763 |
| UniProt ID | O81006 |
| mRNA ID | NM_127854 |
| Length | 279 |
| RefSeq Status | REVIEWED |
| MATSLQTKYTLNPITNNIPRSHRPSFLRVTSTTNSQPNHEMKLVVEQRLVNPPLSNDPTLQSTWTHRLWVAAGCTTVFVSFSKSIIGAFGSHLWLEPSLAGFAGYILADLGSGVYHWATDNYGDESTPLVGIHIEDSQDHHKCPWTITKRQFANNLHFMARGTTLIVLPLDLAFDDHVVHGFVSMFAFCVLFCQLFHAWAHGTKSKLPPLVVGLQDIGLLVSRIHHMNHHRAPYNNNYCVVSGVWNKVLDESNVFKAMEMVLYIQLGVRPRSWTEPNYE | |
Gene Information
Entrez Gene ID
Gene Name
Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IEA:UniProtKB-KW | C | chloroplast |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
| GO:0006631 | IEA:UniProtKB-UniPathway | P | fatty acid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019547 | B-domain containing protein Kua |
UniProt Annotations
Entry Information
Gene Name
Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Protein Entry
FD4L2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O81006-1; Sequence=Displayed; Note=Derived from EST data. No experimental confirmation available.; Name=2; IsoId=O81006-2; Sequence=VSP_055334; Note=No experimental confirmation available.; |
| Function | Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species. Catalyzes the formation of a trans double bond introduced close to the carboxyl group of palmitic acid, which is specifically esterified to the sn-2 glyceryl carbon of phosphatidylglycerol (By similarity). {ECO:0000250}. |
| Pathway | Lipid metabolism; fatty acid metabolism. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010216 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15227763 | RefSeq | NP_179874 | 279 | Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein |
Identical Sequences to LMP010216 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15227763 | GenBank | AEC07369.1 | 279 | Kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein [Arabidopsis thaliana] |
| GI:15227763 | gnl | TIGR | 279 | unknown protein [Arabidopsis thaliana] |
| GI:15227763 | SwissProt | O81006.1 | 279 | RecName: Full=Fatty acid desaturase 4-like 2, chloroplastic; Short=FAD4-L2; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010216 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15227763 | GenBank | EFH56727.1 | 277 | hypothetical protein ARALYDRAFT_481151 [Arabidopsis lyrata subsp. lyrata] |
| GI:15227763 | GenBank | EOA29356.1 | 283 | hypothetical protein CARUB_v10025642mg [Capsella rubella] |
| GI:15227763 | RefSeq | XP_002880468.1 | 277 | hypothetical protein ARALYDRAFT_481151 [Arabidopsis lyrata subsp. lyrata] |
| GI:15227763 | RefSeq | XP_010417048.1 | 304 | PREDICTED: fatty acid desaturase 4-like 2, chloroplastic [Camelina sativa] |
| GI:15227763 | RefSeq | XP_010429223.1 | 296 | PREDICTED: fatty acid desaturase 4-like 2, chloroplastic [Camelina sativa] |
| GI:15227763 | RefSeq | XP_010472287.1 | 291 | PREDICTED: fatty acid desaturase 4-like 2, chloroplastic [Camelina sativa] |