Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_564741 |
| Protein GI | 186491845 |
| UniProt ID | Q3ECM4 |
| mRNA ID | NM_104641 |
| Length | 349 |
| RefSeq Status | REVIEWED |
| MKIQILLFALVLIFVEANAATQGKNTTIPALIVFGDSIMDTGNNNNLPTLLKCNFPPYGKDYPGGFATGRFSDGRVPSDLIAEKLGLAKTLPAYMNPYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQTHRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKELDGVILYINVYDTLFDMIQHPKKYGFEVADRGCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLLDKYLSKVY | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016298 | IEA:InterPro | F | lipase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPAS-PWY | triacylglycerol degradation |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=AEE33568.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010272 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 186491845 | RefSeq | NP_564741 | 349 | GDSL esterase/lipase |
Identical Sequences to LMP010272 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:186491845 | EMBL | CBC90056.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
| GI:186491845 | GenBank | AEE33560.1 | 349 | GDSL-like lipase/acylhydrolase domain-containing protein [Arabidopsis thaliana] |
| GI:186491845 | GenBank | AEE33577.1 | 349 | GDSL esterase/lipase [Arabidopsis thaliana] |
| GI:186491845 | RefSeq | NP_683444.2 | 349 | GDSL-like lipase/acylhydrolase domain-containing protein [Arabidopsis thaliana] |
| GI:186491845 | SwissProt | P0DI15.1 | 349 | RecName: Full=GDSL esterase/lipase At1g59406; AltName: Full=Extracellular lipase At1g59406; Flags: Precursor [Arabidopsis thaliana] |
| GI:186491845 | SwissProt | F4IBF0.2 | 349 | RecName: Full=GDSL esterase/lipase At1g59030; AltName: Full=Extracellular lipase At1g59030; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010272 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:186491845 | EMBL | CAW53594.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
| GI:186491845 | EMBL | CAW69991.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
| GI:186491845 | EMBL | CAW60379.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
| GI:186491845 | EMBL | CAW44780.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
| GI:186491845 | EMBL | CAW86875.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
| GI:186491845 | GenBank | AEM36355.1 | 349 | At1g59406 [Arabidopsis thaliana] |