Gene/Proteome Database (LMPD)
Proteins
GDSL esterase/lipase | |
---|---|
Refseq ID | NP_564738 |
Protein GI | 79366433 |
UniProt ID | F4IBF0 |
mRNA ID | NM_104633 |
Length | 311 |
RefSeq Status | REVIEWED |
MDTGNNNNLPTLLKCNFPPYGKDYPGGFATGRFSDGRVPSDLIAEKLGLAKTLPAYMNPYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQTHRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKELDGVILYINVYDTLFDMIQHPKKYGFEVADRGCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLLDKYLSKVY |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0016298 | IEA:InterPro | F | lipase activity |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Sequence Caution | Sequence=AEE33568.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; |
Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010273 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
79366433 | RefSeq | NP_564738 | 311 | GDSL esterase/lipase |
Identical Sequences to LMP010273 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79366433 | EMBL | CBC25879.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | EMBL | CBC39404.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | EMBL | CBC10319.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | EMBL | CBC89697.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | EMBL | CBC58567.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | GenBank | AEE33568.1 | 311 | GDSL esterase/lipase [Arabidopsis thaliana] |
Related Sequences to LMP010273 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79366433 | EMBL | CAW53813.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | EMBL | CAW70210.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | EMBL | CAW60598.1 | 349 | unnamed protein product [Arabidopsis thaliana] |
GI:79366433 | GenBank | AEE33577.1 | 349 | GDSL esterase/lipase [Arabidopsis thaliana] |
GI:79366433 | RefSeq | NP_564741.3 | 349 | GDSL esterase/lipase [Arabidopsis thaliana] |
GI:79366433 | RefSeq | NP_683444.2 | 349 | GDSL-like lipase/acylhydrolase domain-containing protein [Arabidopsis thaliana] |