Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_180712 |
| Protein GI | 15225096 |
| UniProt ID | Q9SIQ3 |
| mRNA ID | NM_128711 |
| Length | 360 |
| RefSeq Status | REVIEWED |
| MSTSKAITLTLFIATTLLAPCNAAANATTKPLFPAILIFGDSTVDTGNNNYPLPTIFRAEHFPYGMDLPDGKANGRFSNGKLISDIIATKLNIKEFIPPFLQPNLSDQDILTGVCFASAGAGYDDLTSLSTQAIRVSEQPNMFKSYIARLKGIVGDKKAMEIINNAFVVVSAGPNDFILNYYEIPSRRLEYPFISGYQDFILKRLENFVRELYSLGVRNVLVGGLPPMGCLPIHMTAKFRNIFRFCLEHHNKDSVLYNEKLQNLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFKETKRGCCGTGFLETSFMCNVFSPVCQNRSEFLFFDSIHPSEATYNVIGNLLDPLIRGKFQA | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPAS-PWY | triacylglycerol degradation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010289 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15225096 | RefSeq | NP_180712 | 360 | GDSL esterase/lipase |
Identical Sequences to LMP010289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15225096 | EMBL | CBC39308.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CBC10270.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CBC89601.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CBC58471.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | GenBank | ACX16810.1 | 360 | Sequence 44066 from patent US 7569389 |
| GI:15225096 | GenBank | AEC08558.1 | 360 | GDSL esterase/lipase [Arabidopsis thaliana] |
Related Sequences to LMP010289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15225096 | EMBL | CAW53806.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CAW70203.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CAW60591.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CAW44992.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | EMBL | CAW87364.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:15225096 | GenBank | ACX16809.1 | 366 | Sequence 44065 from patent US 7569389 |