Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_188100 |
| Protein GI | 186510072 |
| UniProt ID | Q9LH73 |
| mRNA ID | NM_112343 |
| Length | 351 |
| RefSeq Status | REVIEWED |
| MDLHLIGFLLWFFVVQVTTSSAHRNITTTIPALIVFGDSIMDTGNNNDIPTLLKSNFPPYGRDFPGAIPTGRFSDGKVPSDIIAESLGIAKTLPPYLGSNLKPHDLLKGVIFASGGSGYDPLTSTLLSVVSMSDQLKYFQEYLAKIKQHFGEEKVKFILEKSVFLVVSSSNDLAETYWVRSVEYDRNSYAEYLVELASEFIKELSELGAKNIGLFSGVPVGCLPAQRTLFGGFERKCYEKLNNMALHFNSKLSSSLDTLKKELPSRLIFIDVYDTLLDIIKNPTNYGFKVADKGCCGTGKIELMELCNKFTPFTCSDASTHVFFDSYHPSEKAYQIITHKLLAKYRKYLNT | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016298 | IEA:InterPro | F | lipase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPAS-PWY | triacylglycerol degradation |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=BAB02648.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010298 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 186510072 | RefSeq | NP_188100 | 351 | GDSL esterase/lipase |
Identical Sequences to LMP010298 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:186510072 | GenBank | AEE75570.1 | 351 | GDSL esterase/lipase [Arabidopsis thaliana] |
| GI:186510072 | SwissProt | Q9LH73.2 | 351 | RecName: Full=GDSL esterase/lipase At3g14820; AltName: Full=Extracellular lipase At3g14820; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010298 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:186510072 | DBBJ | BAB02648.1 | 311 | GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana] |
| GI:186510072 | EMBL | CAM55411.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
| GI:186510072 | EMBL | CAW69987.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
| GI:186510072 | EMBL | CAW60375.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
| GI:186510072 | EMBL | CAW44776.1 | 311 | unnamed protein product [Arabidopsis thaliana] |
| GI:186510072 | EMBL | CAW86864.1 | 311 | unnamed protein product [Arabidopsis thaliana] |