Gene/Proteome Database (LMPD)

LMPD ID
LMP010396
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glucose-6-phosphate acetyltransferase 1
Gene Symbol
Synonyms
AtGNA1; F14F8.150; F14F8_150; glucose-6-phosphate acetyltransferase 1; GNA1
Alternate Names
glucose-6-phosphate acetyltransferase 1
Chromosome
5
EC Number
2.3.1.4

Proteins

glucose-6-phosphate acetyltransferase 1
Refseq ID NP_197081
Protein GI 15242389
UniProt ID Q9LFU9
mRNA ID NM_121582
Length 149
RefSeq Status REVIEWED
MAETFKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKIAATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKVILDCSVENKVFYEKCGMSNKSIQMSKYFD

Gene Information

Entrez Gene ID
Gene Name
glucose-6-phosphate acetyltransferase 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0004343 IDA:TAIR F glucosamine 6-phosphate N-acetyltransferase activity
GO:0006044 IDA:TAIR P N-acetylglucosamine metabolic process
GO:0006048 IEA:UniProtKB-UniPathway P UDP-N-acetylglucosamine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00520 Amino sugar and nucleotide sugar metabolism
ath01110 Biosynthesis of secondary metabolites

REACTOME Pathway Links

REACTOME Pathway ID Description
6254222 Synthesis of UDP-N-acetyl-glucosamine
6254038 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR016181 Acyl-CoA N-acyltransferase
IPR000182 GNAT domain

UniProt Annotations

Entry Information

Gene Name
glucose-6-phosphate acetyltransferase 1
Protein Entry
GNA1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=33 uM for acetyl-coenzyme A {ECO:0000269|PubMed:22329777}; KM=231 uM for glucosamine-6-phosphate {ECO:0000269|PubMed:22329777}; pH dependence: Optimum pH is 7.0-8.0. {ECO:0000269|PubMed:22329777}; Temperature dependence: Optimum temperature is 35 degrees Celsius. {ECO:0000269|PubMed:22329777};
Catalytic Activity Acetyl-CoA + D-glucosamine 6-phosphate = CoA + N-acetyl-D-glucosamine 6-phosphate. {ECO:0000269|PubMed:22329777}.
Disruption Phenotype Retarded vegetative growth, delayed flowering and short and thick inflorescence stems and siliques. {ECO:0000269|PubMed:22932674}.
Function Acetyltransferase involved in UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthesis. UDP-GlcNAc is an essential metabolite that serves as an initial sugar donor for N-glycan synthesis and thus plays an important role in protein and lipid glycosylation. {ECO:0000269|PubMed:22329777, ECO:0000269|PubMed:22932674}.
Miscellaneous The mutant lignescens (lig) was originally isolated as a temperature-sensitive mutant that exhibits ectopic lignin deposition and growth defects under high-temperature conditions. {ECO:0000305|PubMed:22932674}.
Pathway Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D- glucosamine biosynthesis; N-acetyl-alpha-D-glucosamine 1-phosphate from alpha-D-glucosamine 6-phosphate (route I): step 1/2.
Similarity Belongs to the acetyltransferase family. GNA1 subfamily. {ECO:0000305}.
Similarity Contains 1 N-acetyltransferase domain. {ECO:0000255|PROSITE-ProRule:PRU00532}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:22329777}; Peripheral membrane protein {ECO:0000269|PubMed:22329777}.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Expressed in roots, leaves, stems, cauline leaves, flowers and siliques. {ECO:0000269|PubMed:22329777}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010396 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15242389 RefSeq NP_197081 149 glucose-6-phosphate acetyltransferase 1

Identical Sequences to LMP010396 proteins

Reference Database Accession Length Protein Name
GI:15242389 EMBL CAC01776.1 149 acetyltransferase-like protein [Arabidopsis thaliana]
GI:15242389 GenBank ACC03358.1 149 Sequence 34 from patent US 7332304
GI:15242389 GenBank AFD38724.1 149 Sequence 34 from patent US 8124381
GI:15242389 gnl TAIR 149 glucose-6-phosphate acetyltransferase 1 [Arabidopsis thaliana]
GI:15242389 PDB 3T90 149 Chain A, Crystal Structure Of Glucosamine-6-Phosphate N-Acetyltransferase From Arabidopsis Thaliana
GI:15242389 SwissProt Q9LFU9.1 149 RecName: Full=Glucosamine 6-phosphate N-acetyltransferase; AltName: Full=Glucose-6-phosphate acetyltransferase 1; Short=AtGNA1; AltName: Full=Phosphoglucosamine acetylase; AltName: Full=Phosphoglucosamine transacetylase; AltName: Full=Protein LIGNESCENS [Arabidopsis thaliana]

Related Sequences to LMP010396 proteins

Reference Database Accession Length Protein Name
GI:15242389 GenBank EFH49999.1 149 hypothetical protein ARALYDRAFT_909552 [Arabidopsis lyrata subsp. lyrata]
GI:15242389 GenBank EOA22064.1 149 hypothetical protein CARUB_v10002604mg [Capsella rubella]
GI:15242389 GenBank ESQ41554.1 160 hypothetical protein EUTSA_v10014892mg [Eutrema salsugineum]
GI:15242389 RefSeq XP_002873740.1 149 hypothetical protein ARALYDRAFT_909552 [Arabidopsis lyrata subsp. lyrata]
GI:15242389 RefSeq XP_006289166.1 149 hypothetical protein CARUB_v10002604mg [Capsella rubella]
GI:15242389 RefSeq XP_010420250.1 151 PREDICTED: glucosamine 6-phosphate N-acetyltransferase [Camelina sativa]