Gene/Proteome Database (LMPD)

LMPD ID
LMP010411
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Gene Symbol
Synonyms
ATGPAT4; F22L4.15; F22L4_15; glycerol-3-phosphate acyltransferase 4; GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE 4; GPAT4
Alternate Names
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Chromosome
1
EC Number
2.3.1.198
Summary
Encodes a protein with glycerol-3-phosphate acyltransferase activity. Involved in cutin assembly. Is functional redundant of GPAT8.
Orthologs

Proteins

bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Refseq ID NP_171667
Protein GI 15223437
UniProt ID Q9LMM0
mRNA ID NM_100043
Length 503
RefSeq Status REVIEWED
MSPAKKSRSFPPISECKSREYDSIAADLDGTLLLSRSSFPYFMLVAIEAGSLFRGLILLLSLPIVIIAYLFVSESLGIQILIFISFAGIKIKNIELVSRAVLTRFYAADVRKDSFEVFDKCKKRKVVVTANPIVMVEPFVKDYLGGDKVLGTEIEVNPKTMKATGFVKKPGVLVGDLKRLAILKEFGDDSPDLGLGDRTSDHDFMSICKEGYMVHETKSATTVPIESLKNRIIFHDGRLVQRPTPLNALIIYLWLPFGFMLSVFRVYFNLPLPERFVRYTYEILGIHLTIRGHRPPPPSPGKPGNLYVLNHRTALDPIIIAIALGRKITCVTYSVSRLSLMLSPIPAVALTRDRVADAARMRQLLEKGDLVICPEGTTCREPYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPFEVANYVQKVIGGVLGFECTELTRKDKYLLLGGNDGKVESINKTKSME

Gene Information

Entrez Gene ID
Gene Name
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0090447 IDA:TAIR F glycerol-3-phosphate 2-O-acyltransferase activity
GO:0016791 IDA:TAIR F phosphatase activity
GO:0010143 IMP:TAIR P cutin biosynthetic process
GO:0016311 IDA:GOC P dephosphorylation
GO:0008654 IEA:UniProtKB-KW P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00561 Glycerolipid metabolism
ath00564 Glycerophospholipid metabolism
ko00564 Glycerophospholipid metabolism
ath01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Protein Entry
GPAT4_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: Vmax=58.92 pmol/min/mg enzyme {ECO:0000269|PubMed:12897259};
Catalytic Activity An acyl-CoA + sn-glycerol 3-phosphate = CoA + a 2-acyl-sn-glycerol 3-phosphate. {ECO:0000269|PubMed:12897259, ECO:0000269|PubMed:20551224}.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}.
Function Esterifies acyl-group from acyl-ACP to the sn-2 position of glycerol-3-phosphate, a step in cutin biosynthesis. {ECO:0000269|PubMed:20551224}.
Similarity Belongs to the GPAT/DAPAT family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Widely expressed at high level. Highly expressed in seedlings, developing seedlings and flower buds. {ECO:0000269|PubMed:12897259}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010411 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15223437 RefSeq NP_171667 503 bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase

Identical Sequences to LMP010411 proteins

Reference Database Accession Length Protein Name
GI:15223437 GenBank AAF81319.1 503 Contains similarity to a hypothetical protein F16M14.4 gi|7485589 from Arabidopsis thaliana BAC F16M14 gb|T01243 [Arabidopsis thaliana]
GI:15223437 GenBank ACX17212.1 503 Sequence 44610 from patent US 7569389
GI:15223437 GenBank AEE27311.1 503 glycerol-3-phosphate sn-2-acyltransferase [Arabidopsis thaliana]
GI:15223437 SwissProt Q9LMM0.1 503 RecName: Full=Glycerol-3-phosphate 2-O-acyltransferase 4; Short=AtGPAT4; AltName: Full=Glycerol-3-phosphate acyltransferase 4 [Arabidopsis thaliana]

Related Sequences to LMP010411 proteins

Reference Database Accession Length Protein Name
GI:15223437 GenBank AAL32544.1 503 Unknown protein [Arabidopsis thaliana]
GI:15223437 GenBank AAM13293.1 503 unknown protein [Arabidopsis thaliana]
GI:15223437 GenBank ACX21531.1 503 Sequence 50448 from patent US 7569389
GI:15223437 GenBank EFH65620.1 502 glycerol-3-phosphate acyltransferase 4 [Arabidopsis lyrata subsp. lyrata]
GI:15223437 RefSeq XP_002889361.1 502 glycerol-3-phosphate acyltransferase 4 [Arabidopsis lyrata subsp. lyrata]
GI:15223437 RefSeq XP_010474768.1 502 PREDICTED: glycerol-3-phosphate 2-O-acyltransferase 4 [Camelina sativa]