Gene/Proteome Database (LMPD)
LMPD ID
LMP010411
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Gene Symbol
Synonyms
ATGPAT4; F22L4.15; F22L4_15; glycerol-3-phosphate acyltransferase 4; GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE 4; GPAT4
Alternate Names
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Chromosome
1
EC Number
2.3.1.198
Summary
Encodes a protein with glycerol-3-phosphate acyltransferase activity. Involved in cutin assembly. Is functional redundant of GPAT8.
Orthologs
Proteins
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase | |
---|---|
Refseq ID | NP_171667 |
Protein GI | 15223437 |
UniProt ID | Q9LMM0 |
mRNA ID | NM_100043 |
Length | 503 |
RefSeq Status | REVIEWED |
MSPAKKSRSFPPISECKSREYDSIAADLDGTLLLSRSSFPYFMLVAIEAGSLFRGLILLLSLPIVIIAYLFVSESLGIQILIFISFAGIKIKNIELVSRAVLTRFYAADVRKDSFEVFDKCKKRKVVVTANPIVMVEPFVKDYLGGDKVLGTEIEVNPKTMKATGFVKKPGVLVGDLKRLAILKEFGDDSPDLGLGDRTSDHDFMSICKEGYMVHETKSATTVPIESLKNRIIFHDGRLVQRPTPLNALIIYLWLPFGFMLSVFRVYFNLPLPERFVRYTYEILGIHLTIRGHRPPPPSPGKPGNLYVLNHRTALDPIIIAIALGRKITCVTYSVSRLSLMLSPIPAVALTRDRVADAARMRQLLEKGDLVICPEGTTCREPYLLRFSALFAELSDRIVPVAMNCKQGMFNGTTVRGVKFWDPYFFFMNPRPSYEATFLDRLPEEMTVNGGGKTPFEVANYVQKVIGGVLGFECTELTRKDKYLLLGGNDGKVESINKTKSME |
Gene Information
Entrez Gene ID
Gene Name
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0090447 | IDA:TAIR | F | glycerol-3-phosphate 2-O-acyltransferase activity |
GO:0016791 | IDA:TAIR | F | phosphatase activity |
GO:0010143 | IMP:TAIR | P | cutin biosynthetic process |
GO:0016311 | IDA:GOC | P | dephosphorylation |
GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase
Protein Entry
GPAT4_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: Vmax=58.92 pmol/min/mg enzyme {ECO:0000269|PubMed:12897259}; |
Catalytic Activity | An acyl-CoA + sn-glycerol 3-phosphate = CoA + a 2-acyl-sn-glycerol 3-phosphate. {ECO:0000269|PubMed:12897259, ECO:0000269|PubMed:20551224}. |
Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}. |
Function | Esterifies acyl-group from acyl-ACP to the sn-2 position of glycerol-3-phosphate, a step in cutin biosynthesis. {ECO:0000269|PubMed:20551224}. |
Similarity | Belongs to the GPAT/DAPAT family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Tissue Specificity | Widely expressed at high level. Highly expressed in seedlings, developing seedlings and flower buds. {ECO:0000269|PubMed:12897259}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010411 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15223437 | RefSeq | NP_171667 | 503 | bifunctional sn-glycerol-3-phosphate 2-O-acyltransferase/phosphatase |
Identical Sequences to LMP010411 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15223437 | GenBank | AAF81319.1 | 503 | Contains similarity to a hypothetical protein F16M14.4 gi|7485589 from Arabidopsis thaliana BAC F16M14 gb|T01243 [Arabidopsis thaliana] |
GI:15223437 | GenBank | ACX17212.1 | 503 | Sequence 44610 from patent US 7569389 |
GI:15223437 | GenBank | AEE27311.1 | 503 | glycerol-3-phosphate sn-2-acyltransferase [Arabidopsis thaliana] |
GI:15223437 | SwissProt | Q9LMM0.1 | 503 | RecName: Full=Glycerol-3-phosphate 2-O-acyltransferase 4; Short=AtGPAT4; AltName: Full=Glycerol-3-phosphate acyltransferase 4 [Arabidopsis thaliana] |
Related Sequences to LMP010411 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15223437 | GenBank | AAL32544.1 | 503 | Unknown protein [Arabidopsis thaliana] |
GI:15223437 | GenBank | AAM13293.1 | 503 | unknown protein [Arabidopsis thaliana] |
GI:15223437 | GenBank | ACX21531.1 | 503 | Sequence 50448 from patent US 7569389 |
GI:15223437 | GenBank | EFH65620.1 | 502 | glycerol-3-phosphate acyltransferase 4 [Arabidopsis lyrata subsp. lyrata] |
GI:15223437 | RefSeq | XP_002889361.1 | 502 | glycerol-3-phosphate acyltransferase 4 [Arabidopsis lyrata subsp. lyrata] |
GI:15223437 | RefSeq | XP_010474768.1 | 502 | PREDICTED: glycerol-3-phosphate 2-O-acyltransferase 4 [Camelina sativa] |