Gene/Proteome Database (LMPD)
Proteins
glycerophosphodiester phosphodiesterase | |
---|---|
Refseq ID | NP_199144 |
Protein GI | 79528247 |
UniProt ID | Q680A6 |
mRNA ID | NM_123696 |
Length | 370 |
RefSeq Status | REVIEWED |
MALETMTLSLSSSAMLSSGVVEDDKKQEAIVFPKFVLMGHRGFGMNMLQSPDEKMKFIKENSLLSFNVAADFPIDFIEFDVQVTRDGCPVIFHDIFMFTQEQGVIIEKRVTEMDLHEFLSYGPQRDGTNVKPMWRKTKDGRIFEWKVEKDDPLCTLEDAFLNVKHSLGFNIELKFDDNTVYGEGELRQTLDNILTVVNEHSKNRPIIFSSFHPDAARLIRNMQRCYPVFFLTNGGCEIYKDVRRNSLDEAIKLCKESGLQGLVSEVKAILRTPNAITRVKDSKLSLLSYGQLNNVVEVIYLQYLMGVEGVIVDMVKDISEAIANIEVTNEDDCEGEDERKCLIRFGEERKKVEITKDMITLLNKFVPKLL |
Gene Information
Entrez Gene ID
Gene Name
glycerophosphodiester phosphodiesterase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008081 | IEA:InterPro | F | phosphoric diester hydrolase activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY0-381 | glycerol and glycerophosphodiester degradation |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR017946 | PLC-like phosphodiesterase, TIM beta/alpha-barrel domain |
UniProt Annotations
Entry Information
Gene Name
glycerophosphodiester phosphodiesterase
Protein Entry
GDPD3_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A glycerophosphodiester + H(2)O = an alcohol + sn-glycerol 3-phosphate. {ECO:0000250|UniProtKB:Q9SGA2}. |
Induction | By phosphate starvation. {ECO:0000269|PubMed:21323773}. |
Sequence Caution | Sequence=BAB10593.1; Type=Erroneous gene model prediction; |
Similarity | Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}. |
Similarity | Contains 1 GP-PDE domain. {ECO:0000255}. |
Tissue Specificity | Expressed in flowers and siliques. {ECO:0000269|PubMed:21323773}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010420 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
79528247 | RefSeq | NP_199144 | 370 | glycerophosphodiester phosphodiesterase |
Identical Sequences to LMP010420 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79528247 | DBBJ | BAD43724.1 | 370 | unnamed protein product [Arabidopsis thaliana] |
GI:79528247 | gnl | TAIR | 370 | glycerophosphodiester phosphodiesterase [Arabidopsis thaliana] |
GI:79528247 | SwissProt | Q680A6.1 | 370 | RecName: Full=Glycerophosphodiester phosphodiesterase GDPD3; AltName: Full=Glycerophosphodiester phosphodiesterase 3; Short=ATGDPD3 [Arabidopsis thaliana] |
Related Sequences to LMP010420 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79528247 | GenBank | AAQ62421.1 | 333 | At5g43300 [Arabidopsis thaliana] |
GI:79528247 | GenBank | EFH39926.1 | 372 | glycerophosphodiester phosphodiesterase [Arabidopsis lyrata subsp. lyrata] |
GI:79528247 | GenBank | EOA14983.1 | 376 | hypothetical protein CARUB_v10028331mg [Capsella rubella] |
GI:79528247 | RefSeq | XP_002863667.1 | 372 | glycerophosphodiester phosphodiesterase [Arabidopsis lyrata subsp. lyrata] |
GI:79528247 | RefSeq | XP_010481874.1 | 372 | PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase GDPD3-like [Camelina sativa] |
GI:79528247 | RefSeq | XP_010494310.1 | 379 | PREDICTED: glycerophosphodiester phosphodiesterase GDPD3-like [Camelina sativa] |