Gene/Proteome Database (LMPD)
Proteins
| glycerophosphoryl diester phosphodiesterase | |
|---|---|
| Refseq ID | NP_177561 |
| Protein GI | 15221164 |
| UniProt ID | Q9C907 |
| mRNA ID | NM_106081 |
| Length | 392 |
| RefSeq Status | REVIEWED |
| MILTRCLPLIWLSLLTVCAAGRTLHPLPVKGPKTVKLQLQTSRPYNIAHRGSNGEIPEETTAAYLKAIEEGTDFIETDILSSKDGVLICFHDCILDETTNVASHKEFADRKRTYDVQGFNITGFFTFDFTLKELKQLRIKQRYAFRDQQYNGMYPIITFEEFLTIARDAPRVVGIYPEIKNPVLMNQHVKWPGGKKFEDKVVETLKKYGYGGSYLSKKWLKKPLFIQSFAPTSLVYISNLTDSPKVLLIDDVTMPTQDTNQTYAEITSDAYFEYIKQYVVGIGPWKDTIVPVNNNYVLAPTDLVKRAHAHNLQVHPYTYRNEHEFLHYNFSQDPYKEYDYWINEIGVDGLFTDFTGSLHNFQEWTSPLPDTSKSPRQLLSQIASLVLPYAKA | |
Gene Information
Entrez Gene ID
Gene Name
glycerophosphoryl diester phosphodiesterase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005773 | IDA:TAIR | C | vacuole |
| GO:0008889 | IEA:InterPro | F | glycerophosphodiester phosphodiesterase activity |
| GO:0006071 | IEA:InterPro | P | glycerol metabolic process |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00564 | Glycerophospholipid metabolism |
| ko00564 | Glycerophospholipid metabolism |
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycerophosphoryl diester phosphodiesterase
Protein Entry
GDPD5_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A glycerophosphodiester + H(2)O = an alcohol + sn-glycerol 3-phosphate. {ECO:0000250|UniProtKB:Q9SGA2}. |
| Induction | By phosphate starvation. {ECO:0000269|PubMed:21323773}. |
| Similarity | Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}. |
| Similarity | Contains 1 GP-PDE domain. {ECO:0000255}. |
| Subcellular Location | Secreted, cell wall {ECO:0000303|PubMed:14750903}. Vacuole {ECO:0000303|PubMed:14750903}. |
| Tissue Specificity | Expressed in roots, rosette and cauline leaves, stems, flowers and siliques. {ECO:0000269|PubMed:21323773}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010425 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221164 | RefSeq | NP_177561 | 392 | glycerophosphoryl diester phosphodiesterase |
Identical Sequences to LMP010425 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221164 | EMBL | CBG07162.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221164 | EMBL | CBV20684.1 | 392 | unnamed protein product [Arabidopsis thaliana] |
| GI:15221164 | GenBank | AAN13192.1 | 392 | putative glycerophosphodiester phosphodiesterase [Arabidopsis thaliana] |
| GI:15221164 | GenBank | AEE35566.1 | 392 | glycerophosphoryl diester phosphodiesterase [Arabidopsis thaliana] |
| GI:15221164 | GenBank | AGX98631.1 | 392 | Sequence 77504 from patent US 8541208 |
| GI:15221164 | SwissProt | Q9C907.1 | 392 | RecName: Full=Glycerophosphodiester phosphodiesterase GDPD5; AltName: Full=Glycerophosphodiester phosphodiesterase 5; Short=ATGDPD5; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010425 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221164 | GenBank | EFH63790.1 | 391 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221164 | GenBank | ESQ27734.1 | 391 | hypothetical protein EUTSA_v10018684mg [Eutrema salsugineum] |
| GI:15221164 | RefSeq | XP_002887531.1 | 391 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221164 | RefSeq | XP_006390448.1 | 391 | hypothetical protein EUTSA_v10018684mg [Eutrema salsugineum] |
| GI:15221164 | RefSeq | XP_010416272.1 | 392 | PREDICTED: glycerophosphodiester phosphodiesterase GDPD5-like [Camelina sativa] |
| GI:15221164 | RefSeq | XP_010428404.1 | 392 | PREDICTED: glycerophosphodiester phosphodiesterase GDPD5 [Camelina sativa] |