Gene/Proteome Database (LMPD)

LMPD ID
LMP010460
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Hexaprenyldihydroxybenzoate methyltransferase
Gene Symbol
Synonyms
ATCOQ3; coenzyme Q 3; COQ3; EMB3002; embryo defective 3002; F7F1.13; F7F1_13
Alternate Names
Hexaprenyldihydroxybenzoate methyltransferase
Chromosome
2
EC Number
2.1.1.114
Summary
The enzyme encoded by this gene has been shown to complement the Saccharomyces cerevisiae coq3 mutation and, therefore, to have hexaprenyldihydroxybenzoate methyltransferase activity. It is however likely that, in Arabidopsis, the enzyme catalyzes the methylation of nonaprenyldihydroxybenzoate as it is the prevalent polyprenoid in this plant species. The enzyme is a mitochondrial-localized methyltransferase involved in ubiquinone biosynthesis.
Orthologs

Proteins

Hexaprenyldihydroxybenzoate methyltransferase
Refseq ID NP_180649
Protein GI 15224587
UniProt ID O49354
mRNA ID NM_128644
Length 322
RefSeq Status REVIEWED
MLASVRVNQLQRLLLSARRLSSSPIIPPSRLLHQRLFSTSDTDASAASFSSSHPKIQTLEGKASNKSRSTSSTTSLNEDELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIRSTLCRHFSKDPSSAKPFEGLKFIDIGCGGGLLSEPLARMGATVTGVDAVDKNVKIARLHADMDPVTSTIEYLCTTAEKLADEGRKFDAVLSLEVIEHVANPAEFCKSLSALTIPNGATVLSTINRTMRAYASTIVGAEYILRWLPKGTHQWSSFVTPEEMSMILQRASVDVKEIAGFVYNPITGRWLLSDDISVNYIAYGTKRKDLGDI

Gene Information

Entrez Gene ID
Gene Name
Hexaprenyldihydroxybenzoate methyltransferase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005740 IDA:TAIR C mitochondrial envelope
GO:0008425 IEA:InterPro F 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
GO:0008689 IEA:UniProtKB-EC F 3-demethylubiquinone-9 3-O-methyltransferase activity
GO:0004395 IGI:TAIR F hexaprenyldihydroxybenzoate methyltransferase activity
GO:0010420 IGI:TAIR F polyprenyldihydroxybenzoate methyltransferase activity
GO:0006744 IGI:TAIR P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath01100 Metabolic pathways
ath00130 Ubiquinone and other terpenoid-quinone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254375 Ubiquinol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR013216 Methyltransferase type 11
IPR029063 S-adenosyl-L-methionine-dependent methyltransferase
IPR010233 Ubiquinone biosynthesis O-methyltransferase

UniProt Annotations

Entry Information

Gene Name
Hexaprenyldihydroxybenzoate methyltransferase
Protein Entry
COQ3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity S-adenosyl-L-methionine + 3,4-dihydroxy-5-all- trans-polyprenylbenzoate = S-adenosyl-L-homocysteine + 3-methoxy- 4-hydroxy-5-all-trans-polyprenylbenzoate.
Catalytic Activity S-adenosyl-L-methionine + 3- demethylubiquinone-n = S-adenosyl-L-homocysteine + ubiquinone-n.
Catalytic Activity S-adenosyl-L-methionine + 3-(all-trans- polyprenyl)benzene-1,2-diol = S-adenosyl-L-homocysteine + 2- methoxy-6-(all-trans-polyprenyl)phenol.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the methyltransferase superfamily. UbiG/COQ3 family. {ECO:0000305}.
Subcellular Location Mitochondrion matrix {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010460 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15224587 RefSeq NP_180649 322 Hexaprenyldihydroxybenzoate methyltransferase

Identical Sequences to LMP010460 proteins

Reference Database Accession Length Protein Name
GI:15224587 GenBank AAK76502.1 322 putative dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana]
GI:15224587 GenBank AAM14305.1 322 putative dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana]
GI:15224587 GenBank AEC08458.1 322 Hexaprenyldihydroxybenzoate methyltransferase [Arabidopsis thaliana]
GI:15224587 gnl TIGR 322 dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana]
GI:15224587 SwissProt O49354.2 322 RecName: Full=Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; AltName: Full=2-polyprenyl-6-hydroxyphenol methylase; AltName: Full=3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; Short=DHHB methyltransferase; Short=DHHB-MT; Short=DHHB-MTase; AltName: Full=3-demethylubiquinone-n 3-methyltransferase; AltName: Full=Dihydroxyhexaprenylbenzoate methyltransferase; AltName: Full=Protein EMBRYO DEFECTIVE 3002; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010460 proteins

Reference Database Accession Length Protein Name
GI:15224587 EMBL CAA75340.1 322 dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana]
GI:15224587 GenBank AAM61022.1 322 dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana]
GI:15224587 GenBank EFH57397.1 323 ATCOQ3 [Arabidopsis lyrata subsp. lyrata]
GI:15224587 GenBank EOA28474.1 322 hypothetical protein CARUB_v10024681mg [Capsella rubella]
GI:15224587 RefSeq XP_002881138.1 323 ATCOQ3 [Arabidopsis lyrata subsp. lyrata]
GI:15224587 RefSeq XP_006295576.1 322 hypothetical protein CARUB_v10024681mg [Capsella rubella]