Gene/Proteome Database (LMPD)
LMPD ID
LMP010460
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Hexaprenyldihydroxybenzoate methyltransferase
Gene Symbol
Synonyms
ATCOQ3; coenzyme Q 3; COQ3; EMB3002; embryo defective 3002; F7F1.13; F7F1_13
Alternate Names
Hexaprenyldihydroxybenzoate methyltransferase
Chromosome
2
EC Number
2.1.1.114
Summary
The enzyme encoded by this gene has been shown to complement the Saccharomyces cerevisiae coq3 mutation and, therefore, to have hexaprenyldihydroxybenzoate methyltransferase activity. It is however likely that, in Arabidopsis, the enzyme catalyzes the methylation of nonaprenyldihydroxybenzoate as it is the prevalent polyprenoid in this plant species. The enzyme is a mitochondrial-localized methyltransferase involved in ubiquinone biosynthesis.
Orthologs
Proteins
| Hexaprenyldihydroxybenzoate methyltransferase | |
|---|---|
| Refseq ID | NP_180649 |
| Protein GI | 15224587 |
| UniProt ID | O49354 |
| mRNA ID | NM_128644 |
| Length | 322 |
| RefSeq Status | REVIEWED |
| MLASVRVNQLQRLLLSARRLSSSPIIPPSRLLHQRLFSTSDTDASAASFSSSHPKIQTLEGKASNKSRSTSSTTSLNEDELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIRSTLCRHFSKDPSSAKPFEGLKFIDIGCGGGLLSEPLARMGATVTGVDAVDKNVKIARLHADMDPVTSTIEYLCTTAEKLADEGRKFDAVLSLEVIEHVANPAEFCKSLSALTIPNGATVLSTINRTMRAYASTIVGAEYILRWLPKGTHQWSSFVTPEEMSMILQRASVDVKEIAGFVYNPITGRWLLSDDISVNYIAYGTKRKDLGDI | |
Gene Information
Entrez Gene ID
Gene Name
Hexaprenyldihydroxybenzoate methyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005740 | IDA:TAIR | C | mitochondrial envelope |
| GO:0008425 | IEA:InterPro | F | 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity |
| GO:0008689 | IEA:UniProtKB-EC | F | 3-demethylubiquinone-9 3-O-methyltransferase activity |
| GO:0004395 | IGI:TAIR | F | hexaprenyldihydroxybenzoate methyltransferase activity |
| GO:0010420 | IGI:TAIR | F | polyprenyldihydroxybenzoate methyltransferase activity |
| GO:0006744 | IGI:TAIR | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath01100 | Metabolic pathways |
| ath00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6254375 | Ubiquinol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Hexaprenyldihydroxybenzoate methyltransferase
Protein Entry
COQ3_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | S-adenosyl-L-methionine + 3,4-dihydroxy-5-all- trans-polyprenylbenzoate = S-adenosyl-L-homocysteine + 3-methoxy- 4-hydroxy-5-all-trans-polyprenylbenzoate. |
| Catalytic Activity | S-adenosyl-L-methionine + 3- demethylubiquinone-n = S-adenosyl-L-homocysteine + ubiquinone-n. |
| Catalytic Activity | S-adenosyl-L-methionine + 3-(all-trans- polyprenyl)benzene-1,2-diol = S-adenosyl-L-homocysteine + 2- methoxy-6-(all-trans-polyprenyl)phenol. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the methyltransferase superfamily. UbiG/COQ3 family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion matrix {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010460 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15224587 | RefSeq | NP_180649 | 322 | Hexaprenyldihydroxybenzoate methyltransferase |
Identical Sequences to LMP010460 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15224587 | GenBank | AAK76502.1 | 322 | putative dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana] |
| GI:15224587 | GenBank | AAM14305.1 | 322 | putative dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana] |
| GI:15224587 | GenBank | AEC08458.1 | 322 | Hexaprenyldihydroxybenzoate methyltransferase [Arabidopsis thaliana] |
| GI:15224587 | gnl | TIGR | 322 | dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana] |
| GI:15224587 | SwissProt | O49354.2 | 322 | RecName: Full=Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; AltName: Full=2-polyprenyl-6-hydroxyphenol methylase; AltName: Full=3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase; Short=DHHB methyltransferase; Short=DHHB-MT; Short=DHHB-MTase; AltName: Full=3-demethylubiquinone-n 3-methyltransferase; AltName: Full=Dihydroxyhexaprenylbenzoate methyltransferase; AltName: Full=Protein EMBRYO DEFECTIVE 3002; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010460 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15224587 | EMBL | CAA75340.1 | 322 | dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana] |
| GI:15224587 | GenBank | AAM61022.1 | 322 | dihydroxypolyprenylbenzoate methyltransferase [Arabidopsis thaliana] |
| GI:15224587 | GenBank | EFH57397.1 | 323 | ATCOQ3 [Arabidopsis lyrata subsp. lyrata] |
| GI:15224587 | GenBank | EOA28474.1 | 322 | hypothetical protein CARUB_v10024681mg [Capsella rubella] |
| GI:15224587 | RefSeq | XP_002881138.1 | 323 | ATCOQ3 [Arabidopsis lyrata subsp. lyrata] |
| GI:15224587 | RefSeq | XP_006295576.1 | 322 | hypothetical protein CARUB_v10024681mg [Capsella rubella] |