Gene/Proteome Database (LMPD)
LMPD ID
LMP010494
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glutamine amidotransferase and cyclase
Gene Symbol
Synonyms
HIS HF; HISN4
Alternate Names
glutamine amidotransferase and cyclase
Chromosome
4
EC Number
2.4.2.-
Summary
encodes a glutamine amidotransferase and cyclase, catalyzes the fifth and sixth steps of the histidine biosynthetic pathway
Orthologs
Proteins
| glutamine amidotransferase and cyclase | |
|---|---|
| Refseq ID | NP_194420 |
| Protein GI | 15236905 |
| UniProt ID | Q9SZ30 |
| mRNA ID | NM_118824 |
| Length | 592 |
| RefSeq Status | REVIEWED |
| MEATAAPFSSIVSSRQNFSSSSSIRASSPASLFLSQKSIGNVNRKFKSPRSLSVRASSTSDSVVTLLDYGAGNVRSIRNALRHLGFSIKDVQTPGDILNADRLIFPGVGAFAPAMDVLNRTGMAEALCKYIENDRPFLGICLGLQLLFDSSEENGPVKGLGVIPGIVGRFDASAGIRVPHIGWNALQVGKDSEILDDVGNRHVYFVHSYRAIPSDENKDWISSTCNYGESFISSIRRGNVHAVQFHPEKSGEVGLSVLRRFLHPKLPATQKPMEGKASKLAKRVIACLDVRTNDKGDLVVTKGDQYDVREQSNENEVRNLGKPVDLAGQYYKDGADEISFLNITGFRDFPLGDLPMIQVLRQTSKNVFVPLTVGGGIRDFTDASGRYYSSLEVAAEYFRSGADKISIGSDAVSAAEEFIKSGVKTGKSSLEQISRVYGNQAVVVSIDPRRVYVNHPDDVPYKVIRVTNPGPNGEEYAWYQCTVSGGREGRPIGAFELAKAVEELGAGEILLNCIDCDGQGKGFDIDLVKLISDSVGIPVIASSGAGTPDHFSEVFEKTNASAALAAGIFHRKEVPIQSVKEHLQEERIEVRI | |
Gene Information
Entrez Gene ID
Gene Name
glutamine amidotransferase and cyclase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009570 | IDA:TAIR | C | chloroplast stroma |
| GO:0009536 | IDA:TAIR | C | plastid |
| GO:0000107 | IGI:TAIR | F | imidazoleglycerol-phosphate synthase activity |
| GO:0016833 | IEA:InterPro | F | oxo-acid-lyase activity |
| GO:0006541 | IEA:UniProtKB-KW | P | glutamine metabolic process |
| GO:0000105 | IMP:TAIR | P | histidine biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013785 | Aldolase-type TIM barrel |
| IPR029062 | Class I glutamine amidotransferase-like |
| IPR017926 | Glutamine amidotransferase |
| IPR006062 | Histidine biosynthesis |
| IPR004651 | Histidine biosynthesis, HisF |
| IPR014640 | Imidazole glycerol phosphate synthase HisHF |
| IPR010139 | Imidazole glycerol phosphate synthase, subunit H |
| IPR011060 | Ribulose-phosphate binding barrel |
UniProt Annotations
Entry Information
Gene Name
glutamine amidotransferase and cyclase
Protein Entry
HIS4_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 5-[(5-phospho-1-deoxyribulos-1- ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4- carboxamide + L-glutamine = imidazole-glycerol phosphate + 5- aminoimidazol-4-carboxamide ribonucleotide + L-glutamate + H(2)O. |
| Function | IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR. |
| Pathway | Amino-acid biosynthesis; L-histidine biosynthesis; L- histidine from 5-phospho-alpha-D-ribose 1-diphosphate: step 5/9. |
| Similarity | Contains 1 glutamine amidotransferase type-1 domain. {ECO:0000305}. |
| Similarity | In the C-terminal section; belongs to the HisA/HisF family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010494 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15236905 | RefSeq | NP_194420 | 592 | glutamine amidotransferase and cyclase |
Identical Sequences to LMP010494 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15236905 | EMBL | CAB36536.1 | 592 | glutamine amidotransferase/cyclase [Arabidopsis thaliana] |
| GI:15236905 | EMBL | CAB79545.1 | 592 | glutamine amidotransferase/cyclase [Arabidopsis thaliana] |
| GI:15236905 | EMBL | CBN64397.1 | 592 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236905 | GenBank | AEE85266.1 | 592 | glutamine amidotransferase and cyclase [Arabidopsis thaliana] |
| GI:15236905 | SwissProt | Q9SZ30.1 | 592 | RecName: Full=Imidazole glycerol phosphate synthase hisHF, chloroplastic; Short=IGP synthase; Short=IGPS; Short=ImGP synthase; AltName: Full=Protein HISTIDINE BIOSYNTHESIS 4; Includes: RecName: Full=Glutamine amidotransferase; Includes: RecName: Full=Cyclase; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010494 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15236905 | EMBL | CBF76592.1 | 592 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236905 | EMBL | CBU97696.1 | 592 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236905 | EMBL | CBV20452.1 | 592 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236905 | GenBank | AAO64858.1 | 592 | At4g26900 [Arabidopsis thaliana] |
| GI:15236905 | GenBank | AGX65210.1 | 592 | Sequence 30476 from patent US 8541208 |
| GI:15236905 | GenBank | AGX98393.1 | 592 | Sequence 77030 from patent US 8541208 |