Gene/Proteome Database (LMPD)

LMPD ID
LMP010507
Gene ID
834292
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
inositol-pentakisphosphate 2-kinase 1
Gene Symbol
IPK1
Synonyms
ATIPK1; inositol-pentakisphosphate 2-kinase 1; IPK1; M40H3; MJB21.19; MJB21_19
Alternate Names
inositol-pentakisphosphate 2-kinase 1
Chromosome
5
EC Number
2.7.1.158

Proteins

inositol-pentakisphosphate 2-kinase 1
Refseq ID NP_568613
Protein GI 18422256
UniProt ID Q93YN9
mRNA ID NM_123646
Length 451
RefSeq Status REVIEWED
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNANGVVSVLTSDEQHLWRENNELISSPNKEVLEQRYVKNVIIPLLGPKHVDAGVRVSVSKEFLECVDKKVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISSGGDCISVEIKPKCGFLPTSRFIGKENMLKTSVSRFKMHQLLKLEYNEISEESEYDPLDLFSGSKESVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHSYYDLINQPCPICKEGKPLEAELSLHALPLDESLKIVKEYLIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYYKLDKKIISFYNRKQKAENTAEQIGNSKPSHS

Gene Information

Entrez Gene ID
834292
Gene Name
inositol-pentakisphosphate 2-kinase 1
Gene Symbol
IPK1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0035299 IDA:TAIR F inositol pentakisphosphate 2-kinase activity
GO:0032942 IDA:TAIR F inositol tetrakisphosphate 2-kinase activity
GO:0030643 IMP:TAIR P cellular phosphate ion homeostasis
GO:0042742 IMP:TAIR P defense response to bacterium
GO:0050832 IMP:TAIR P defense response to fungus
GO:0051607 IMP:TAIR P defense response to virus
GO:0010264 IMP:TAIR P myo-inositol hexakisphosphate biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00562 Inositol phosphate metabolism
ath_M00132 Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate

REACTOME Pathway Links

REACTOME Pathway ID Description
6254354 Synthesis of IPs in the nucleus
6254352 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR009286 Inositol-pentakisphosphate 2-kinase

UniProt Annotations

Entry Information

Gene Name
inositol-pentakisphosphate 2-kinase 1
Protein Entry
IPPK_ARATH
UniProt ID
Q93YN9
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=38 uM for Ins(1,3,4,5,6)P5 (in the presence of 0.4 mM ATP) {ECO:0000269|PubMed:16223361}; KM=176 uM for Ins(1,3,4,5,6)P5 (in the presence of 0.4 uM ATP) {ECO:0000269|PubMed:16223361}; Vmax=22 nmol/min/mg enzyme (in the presence of 0.4 mM ATP) {ECO:0000269|PubMed:16223361}; Vmax=1.5 nmol/min/mg enzyme (in the presence of 0.4 uM ATP) {ECO:0000269|PubMed:16223361};
Biotechnology The gene coding for this protein might be inactivated to commercially produce plants with phytate-free grain. Indeed, while the role of phytate (InsP6) accumulation in seeds is unknown, it causes nutritional and environmental problems, partly due to the inability of monogastric animals to digest it.
Catalytic Activity ATP + 1D-myo-inositol 1,3,4,5,6- pentakisphosphate = ADP + 1D-myo-inositol hexakisphosphate. {ECO:0000269|PubMed:16107538, ECO:0000269|PubMed:16223361}.
Domain The EXKPK motif is conserved in inositol-pentakisphosphate 2-kinases of both family 1 and 2.
Function Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). Phytate is a regulator of intracellular signaling, a highly abundant animal antinutrient, and a phosphate store in plant seeds. Also phosphorylates Ins(1,3,4,6)P4 and Ins(1,4,5,6)P4 to produce Ins(1,2,3,4,6)P5 and Ins(1,2,4,5,6)P5. {ECO:0000269|PubMed:16107538, ECO:0000269|PubMed:16223361}.
Sequence Caution Sequence=BAB10637.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the IPK1 type 2 family. {ECO:0000305}.
Tissue Specificity Strongly expressed in leaves and cauline leaves. Weakly expressed in siliques and flowers. In flower, it is expressed in the major organs of developing flower buds. Strongly expressed in sepals, petals, in the male and female organs of immature and mature flower buds. Strongly expressed in the gynoecium and carpels which are fused to form the gynoecium. Also expressed in the transmitting tissue and ovules. {ECO:0000269|PubMed:16223361}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010507 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18422256 RefSeq NP_568613 451 inositol-pentakisphosphate 2-kinase 1

Identical Sequences to LMP010507 proteins

Reference Database Accession Length Protein Name
GI:18422256 GenBank AAL24380.1 451 Unknown protein [Arabidopsis thaliana]
GI:18422256 GenBank AAM13361.1 451 unknown protein [Arabidopsis thaliana]
GI:18422256 GenBank AAZ99216.1 451 inositol polyphosphate IP4/IP5 2-kinase [Arabidopsis thaliana]
GI:18422256 GenBank ADL95167.1 451 Sequence 6 from patent US 7714187
GI:18422256 gnl TAIR 451 inositol-pentakisphosphate 2-kinase 1 [Arabidopsis thaliana]
GI:18422256 SwissProt Q93YN9.1 451 RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 2-kinase; AltName: Full=Ins(1,3,4,5,6)P5 2-kinase; Short=AtIPK1; Short=InsP5 2-kinase [Arabidopsis thaliana]

Related Sequences to LMP010507 proteins

Reference Database Accession Length Protein Name
GI:18422256 PDB 2XAL 451 Chain B, Lead Derivative Of Inositol 1,3,4,5,6-Pentakisphosphate 2- Kinase From A. Thaliana In Complex With Adp And Ip6.
GI:18422256 PDB 2XAM 451 Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. Thaliana In Complex With Adp And Ip6.
GI:18422256 PDB 2XAM 451 Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. Thaliana In Complex With Adp And Ip6.
GI:18422256 PDB 2XAN 451 Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. Thaliana In Complex With Amp Pnp And Ip5
GI:18422256 PDB 2XAN 451 Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. Thaliana In Complex With Amp Pnp And Ip5
GI:18422256 PDB 2XAO 451 Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase From A. Thaliana In Complex With Ip5